KEGG   Brucella suis 1330: BR0690Help
Entry
BR0690            CDS       T00096                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bms  Brucella suis 1330
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bms00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bms00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:bms03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:bms03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bms03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
I:678306..678755
Genome map
AA seq 149 aa AA seqDB search
MAEILFYHLTESTLDEALPGLVERSLGRGWRVTVQTVSEERRDALDSLLWTFSDTSFVAH
GTDKEPNPEHQPVLLTTTETNPNGATVRFLVEGAKLEQAGDYERLVVMFDGHDQDQLDIA
RTQWKAFKAENHDLTYWQQTPDRRWERKA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaatacttttttaccatctgacggaatcgacactggatgaagccctgccaggc
cttgtcgaacgctcgttggggcgtggttggcgcgtaacggttcaaaccgtcagtgaagag
cggcgcgatgcgctggacagcctgctctggaccttttcggacacgtcttttgtggcgcat
ggcacggataaggaacccaatcctgaacatcagcccgtattgttgaccacgactgaaacc
aatcccaacggtgcaacggtccgctttcttgtggaaggcgcgaagctggaacaggccgga
gattatgagcggcttgtggtgatgttcgacgggcatgatcaggatcagctcgacattgcc
cgcacccaatggaaagccttcaaggcggagaaccatgatttgacctattggcagcagacg
cctgaccggcgctgggagcgtaaagcctga

DBGET integrated database retrieval system