KEGG   Brucella suis 1330: BR0879Help
Entry
BR0879            CDS       T00096                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bms  Brucella suis 1330
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bms00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bms00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
I:853074..854087
Genome map
AA seq 337 aa AA seqDB search
MKECKAWIAGISGTKLTPDEIAFFRDETPWGFILFARNVESLEQVSELTAHLRDLTGLDQ
TPVFIDQEGGRVQRLRPPLVPNYPSASEIGAIYARDKEKGLRAAWLHARLHAFDLLKVGV
NADCLPVLDVPVEGAHDVIGMRAYSKNPHAVAEMGRAAAEGLLAGGVLPVVKHMPGHGRA
FSDTHKELARVSVALNELVAHDFVPFKALNDLPMAMTAHVVFDCIDPERPSTLSPTVINT
IIRDVIGFDGLVISDDISMKALSGDLGDITDGIVTAGCDIVLYCSGVMEELVKVAARVPV
LDGKAKRRAELAEVYAGDPDLSDEVRAEFNAMFEPIA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagtgcaaggcatggattgccggtatatccggcacgaagctcaccccggacgag
attgccttcttccgggatgaaaccccgtggggcttcattctttttgctcgcaatgtggaa
agcctcgaacaggtgagcgagctcaccgcccatctgcgtgacctgacggggctggaccag
acgccggttttcatcgatcaggagggcgggcgcgtgcagcgccttcgcccgccgctggta
ccgaactatccgtccgcgtccgaaattggcgcgatctatgcacgcgacaaggaaaagggg
ttgcgtgccgcctggctccatgcccggctccatgctttcgatctgttgaaggtcggcgtc
aatgcggattgcctgccggttctggatgtgccggtggagggcgcgcatgatgtgatcgga
atgcgggcctattccaaaaacccccatgcggttgcggaaatgggacgcgctgccgccgaa
ggtcttctggctggcggcgttcttcccgtcgtgaagcatatgccgggccatggccgcgcc
ttttccgatacgcataaggaactggcgcgggtcagcgttgcgctcaacgaactggttgcg
catgatttcgtgccgttcaaggcgctcaatgatctgccgatggccatgaccgcccatgtg
gtgttcgattgcatcgacccggaaagaccgtccacgctttcgccgacggttattaatacg
atcattcgcgatgtgatcgggttcgacggccttgtcatcagtgacgacatttccatgaag
gcattgtccggcgatcttggcgatataaccgacggcatcgttacggcgggctgcgatatc
gtgctctattgctcaggcgttatggaggaactggtaaaggttgccgcccgtgtgccggtt
ctggatggcaaagcaaagcgccgggccgaactggcggaagtctatgcgggcgaccccgat
ctttccgacgaggtgcgcgccgaattcaatgccatgtttgaaccgatagcgtaa

DBGET integrated database retrieval system