KEGG   Brucella suis 1330: BR1141Help
Entry
BR1141            CDS       T00096                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bms  Brucella suis 1330
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bms01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bms00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
I:1119395..1120201
Genome map
AA seq 268 aa AA seqDB search
MSTDILRKIEAYKREEIAAAKARLALDELKARTRDQSAPRGFLKALEAKRAAGQFALIAE
IKKASPSKGLIRPDFDPPALAKAYEEGGAACLSVLTDTPSFQGAPEFLTAARQACSLPAL
RKDFLFDPYQVYEARSWGADCILIIMASVDDDLAKELEDTAFALGMDALIEVHDEAEMER
ALKLSSRLLGVNNRNLRSFEVNLAVSERLAKMAPSDRLLVGESGIFTHEDCLRLEKSGIG
TFLIGESLMRQHDVAAATRALLTGAEKL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgatattcttcgcaagatcgaagcctataagcgggaagaaatagccgccgcc
aaggcgcgtcttgcccttgatgaactgaaggcccggacgagggatcagtcagcgccgcgc
ggttttctgaaggcacttgaggccaagcgcgccgccggtcaatttgcactgatcgcggag
ataaagaaagcaagcccgtccaaaggcttgatccgccccgatttcgacccgccagcgctt
gcaaaggcttatgaagaaggcggtgcggcctgtctttccgtgctgaccgacacgccttcc
tttcagggcgcgccggaattcctcacggccgcacgccaggcttgcagcctgcccgcattg
cgcaaggatttcctgttcgacccctatcaggtctatgaagcgcgtagctggggagcggat
tgcattctcatcatcatggccagcgtcgatgacgatcttgcaaaagagctggaagacacg
gctttcgcactgggcatggatgcgctgatcgaagtgcatgacgaagctgaaatggaacgc
gccctgaagctttcctcgcgcctgctcggcgtcaacaatcgcaatctgcgcagcttcgag
gtcaatctcgccgtttccgagcggcttgcgaaaatggctccgtccgaccgtctgctggtt
ggcgaaagcggcatcttcacgcatgaggactgcctgcggcttgaaaagtccggcatcggc
acttttctgataggcgaaagccttatgcgacaacatgacgttgcggcagccacccgcgcg
cttttgacgggtgcggaaaagctatga

DBGET integrated database retrieval system