KEGG   Brucella suis 1330: BR1200Help
Entry
BR1200            CDS       T00096                                 

Gene name
phoA
Definition
(GenBank) alkaline phosphatase
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bms  Brucella suis 1330
Pathway
Aminobenzoate degradation
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bms00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BR1200 (phoA)
   00790 Folate biosynthesis
    BR1200 (phoA)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BR1200 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BR1200 (phoA)
Enzymes [BR:bms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BR1200 (phoA)
Exosome [BR:bms04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BR1200 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bms00537]
 Enzymes
  BR1200 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
I:1175517..1176962
Genome map
AA seq 481 aa AA seqDB search
MPRKFTRPLLASAAIIVTFCAPASTVMAQSETAAPLFQRSAKGDLSAAGGARRLDGDITA
AFRDQIRKGPARNVILLIGDGMGDSEITVARNYAVGAGNHFKGIDALPVTGQYTHYSLDK
ESGKPNYVTDSAASGTAWATGVKTYNGAIGVDIHGKPHKTLIELAKEKGLGTGNVSTAEL
QDATPAVQVAHVTHRKCYDPTSTAEKCKDNALENGGPGSISEQLLNTRPDVTLGGGAKYF
EDKARAGTWKGQTLSAQAEARGYQLVRNADTLSKVETANQDKPVLGLFSPGNMPVRWKGP
QAAHHGNLDREPVKCKVNEKRTADIPTLAQMTEKAIDLLKTNEKGFFLQVEGASIDKQDH
AANPCGQIGETVDLDEAVQAALDFARKDGNTLVIVTADHAHASQIIDPDAKAPGLSQALK
TEDGAIMGVTYGNSDEADDQGHTGAQLRIAAFGPGAANFTGLTDQTDMFYTIRDALQLQA
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcccaggaaattcacccggccacttctggcaagcgctgcaattattgtcaccttttgc
gcacccgcaagcaccgtgatggcccagtctgaaactgcggctccactcttccagcgcagc
gcaaaaggcgacctgtcggcagcaggcggcgcacgccgccttgatggtgatattaccgca
gcttttcgcgatcagatcaggaaggggcctgccagaaacgtcatcctgctgatcggagac
ggcatgggcgattccgagatcacggttgcgcgcaattatgcagtcggcgcaggcaatcat
ttcaagggcatcgatgcccttcccgttaccggccagtacacccattattcgctcgacaag
gaaagcggcaagccgaattacgtgactgattctgccgcctccggcaccgcctgggccact
ggcgtcaaaacctataacggcgccatcggcgtcgatattcatggcaaaccgcacaaaacg
ctcattgaactcgccaaggaaaagggcctcggcaccggcaatgtcagcactgccgaattg
caggatgccacacccgccgtgcaggttgcccatgttacccatcgcaagtgctacgaccca
accagcacggcggaaaagtgcaaggataatgcgcttgaaaatggcggcccaggctcgatc
agcgaacagcttttgaacacccgcccggacgtgacattgggcggcggcgcaaaatatttc
gaggacaaggcccgggctggcacatggaaaggccagaccttgagcgcacaggccgaagca
cgcggctatcaactggttagaaatgccgacacattgagcaaggtcgagacagccaatcag
gacaaacctgttctcggcctcttctcaccgggcaacatgccggtccgctggaaagggcct
caggccgcccatcacggcaatctcgacagagagcctgtcaagtgcaaggtcaatgagaag
cgcactgccgatattccgacactggcgcaaatgaccgagaaagccatcgacctgctgaaa
accaacgaaaaaggctttttccttcaggtggaaggtgcctccatcgacaaacaggaccat
gccgccaatccgtgcgggcagatcggcgaaacagtcgatctggatgaagccgtgcaggcc
gcactcgattttgcccgcaaagacggcaacacgcttgtcatcgtaacggccgatcacgcc
catgcaagccagatcattgatcccgatgcgaaggctccgggtttgagccaggcattgaaa
accgaggatggcgcgatcatgggcgtgacctatggcaattccgacgaagccgacgatcag
ggccacacaggcgcgcaattgcgcatagccgcctttggccccggcgctgccaattttacc
ggcctcacggatcagacggatatgttctacacgatccgcgatgccttgcagttgcaggcg
gaataa

DBGET integrated database retrieval system