KEGG   Brucella suis 1330: BR1814Help
Entry
BR1814            CDS       T00096                                 

Gene name
sun
Definition
sun protein (EC:2.1.1.-)
Orthology
K03500  
16S rRNA (cytosine967-C5)-methyltransferase [EC:2.1.1.176]
Organism
bms  Brucella suis 1330
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
I:1743680..1745077
Genome map
AA seq 465 aa AA seqDB search
MNDKKPAPKRGNKKPQTNSNSAADLRPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHP
QYLALEPRDRALVRAILGSALRNRGSIERAINKRLDRPLPENAVALKHLLHVAVAQIFYL
DLPDHSAVDLAVEAANSDPRNRKYAGLVNALLRHLARNKERALAHTFEPEANVPEWFAKS
ITDAYGTEKAATILAMHAYEPPIDFTVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDL
PGFAEGEWWVQDVAASLPARLMGDIKGKRVADLCAAPGGKTAQLVLQGADVTALDLSENR
LKRLNANLERLGFEAKTVATNLMDFKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQD
IAKLAELQGKLLAHAATLVKPGGVIVFSNCSLHPLEGEEMARKAPENPLLEPFPITEQDC
PGLEGLVTAEGFLRSTPADLPPDRLDGNPHMAGMDGFFAARFKRV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgataaaaaacccgcgccgaagcgtggaaacaaaaagccgcaaacgaatagcaac
agcgccgcagacctgcgccccggtctggcggcgcgtttgtgtgcggcccgccttctgggc
gcggtgatcgaaaagaacacctcgctcgacggcctgaccgacaatgcccacggccatccg
caatatctggcgctggagccgcgcgaccgcgcgctggttcgcgccattctgggttctgcg
ctgcgcaatcgcggcagcatcgaacgcgccatcaacaagcggctcgaccggccattgccg
gaaaatgccgtggcgctgaagcatctgctccatgttgccgtcgcccagattttctatctc
gacctgcccgaccattcggcagtcgatcttgcagtcgaggccgcgaacagcgatccgcgc
aaccgcaaatatgccggtctggtcaacgccctgctgcggcatctcgcgcgcaacaaggaa
cgcgcgctcgcccatacatttgagcccgaagccaatgtgccagaatggtttgccaagagc
atcaccgacgcctatggcacggaaaaagcagcgaccattctcgccatgcacgcctatgag
ccgccgatcgatttcacggtcaagggcgatgccaaggcatgggccgaaaagctcggcggc
gtggcgctgcccaatggttcggtgcgcctgcaaacggtggagggcaatctcaccgacctg
cccggctttgccgagggcgaatggtgggtgcaagatgtagcggcaagcctgcctgcgcgc
ctgatgggcgatatcaaaggcaaacgggttgccgatctttgtgccgcccccggcggcaag
acggcgcagcttgtgcttcagggggccgacgtgaccgcgcttgacctgtccgaaaaccgg
ctgaagcgtctcaacgccaatctggaacgcctcggtttcgaggcgaagactgtcgccacc
aatctgatggattttaagcccgacgaactgttcgacgccgtgcttctggatgcgccctgc
tcgtccaccggcacggtgcgccgtcacccggacgtgccatggaccaagacgccgcaggac
attgcaaaactcgcagaacttcagggcaagcttttggcgcacgcagccacgctggtgaaa
cccggcggcgtgatcgtcttttccaattgctcgctgcatccgctcgaaggcgaggaaatg
gcgcgcaaggcgccggaaaatccgctgctggaaccgttcccaatcacggagcaggattgt
cccggccttgaagggctggtgacggcggaaggcttcctgcgctccaccccggcagacctg
ccgccggatcgtttggacggcaatccgcacatggccggcatggacggcttcttcgcggcc
cgtttcaagcgcgtataa

DBGET integrated database retrieval system