KEGG   Brucella suis 1330: BR2110Help
Entry
BR2110            CDS       T00096                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bms  Brucella suis 1330
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BR2110 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BR2110 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BR2110 (trpB)
Enzymes [BR:bms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BR2110 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(2035202..2036422)
Genome map
AA seq 406 aa AA seqDB search
MNKPVAPNSYKTGPDEEGMFGIFGGRFVAETLMPLILELQQAYETAKNDPEFKAELNALS
TFYAGRPSKLYYAEGLSKHLGGAKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCIVYMGATDVERQKPNVFRMKLLGAEVKPVSAGNGTLKD
AMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEARQQILEQEGRLPDVIV
AAVGGGSNAIGLFHPFLDDASVKIVGVEAGGRGLEGEEHCASMSAGRPGVLHGNRTYLLQ
NADGQILEGHSVSAGLDYPGVGPEHSWLKDSGRVDYVPILDNEALDAFQLCTRTEGIIPA
LESAHAIAQAVKMAPTMGKDKVMIVNLSGRGDKDVHTVGKLLGMDI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaagccggttgcacccaattcctacaagacgggccctgacgaagagggcatgttc
ggcatattcggtggccgcttcgtcgccgaaacgctgatgcctctgatcctcgaattgcag
caggcttatgaaacggcgaagaatgaccccgaattcaaggcggagttgaacgccctttcc
accttttatgccggccgtccttccaagctctattatgccgaaggcctgagcaaacatctg
ggtggcgctaaaatctacttcaagcgcgaagacctgaaccataccggcagccacaaaatc
aacaattgccttggccagatcctgcttgccaagcgcatgggcaagacgcgcatcatcgca
gaaacgggcgccggtcagcatggcgtggcgtctgccaccgttgccgcacgcttcggcctg
ccctgtatcgtctatatgggcgcaaccgacgtggagcgccagaagcccaatgttttccgc
atgaagctgctcggcgcggaagtgaagccggtttctgccggcaatggcacgctgaaagac
gcgatgaacgaagccctgcgtgactgggttacgaatgtcgaggatacctattacctgatc
ggcacggctgccggtccgcacccctatcccgaactggtgcgcgatttccaatccgtcatc
ggcaccgaagcgcgccagcagatactcgaacaggaaggccgcctgccagatgtgatcgtg
gcagcggtcggcggcggctccaacgccattggcctgttccatccgttcctcgacgacgcc
tcggtgaagatcgtcggtgtcgaagcaggcggacgcggtcttgagggagaggaacattgc
gcttcgatgagcgcaggccgccccggcgttctgcatggcaaccgcacctatctcctccag
aacgcggatggccaaattctggaaggccattcggtttccgctggtctcgactatccgggc
gtcgggcccgagcattcgtggctgaaggacagcgggcgcgtcgactatgtgccgatcctc
gacaatgaggcgctggatgcattccagctttgcacccgcaccgaaggcatcatcccggcg
ctcgaatccgcccatgccattgcgcaggccgtcaaaatggcgccgacaatgggcaaggac
aaggtgatgatcgtcaatctgtccggccgcggcgacaaggacgtccacacggtcggcaag
cttctcggcatggatatctga

DBGET integrated database retrieval system