KEGG   Brucella suis 1330: BRA0174Help
Entry
BRA0174           CDS       T00096                                 

Gene name
cycA
Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
bms  Brucella suis 1330
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bms00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bms02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:159865..160260
Genome map
AA seq 131 aa AA seqDB search
MRAAMTAISAIAASLLISTVAQGADIESGKKIFNACKACHQIGEGAKNMVGPELNGLFGR
HSGSVEGYKYSDANKNSGIVWDEEIFRKYIKKPREVIPKTKMVYAGLKDEGKIDDLIAFL
KQYDLGGKIKE
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctgcaatgaccgcgatttccgcaatcgcagcttcccttttgatctcgactgtc
gcgcaaggggcggatatcgaatccggcaagaagattttcaacgcatgcaaggcttgccat
cagattggtgagggggcgaaaaatatggtcggccctgagctcaacgggctctttgggcgt
cactcgggttccgtcgaaggatataagtattccgacgcaaacaagaattccggaattgtc
tgggatgaggaaattttccgcaaatacatcaagaagccgcgtgaagtgatcccgaagacc
aagatggtctatgctggcttgaaggatgagggaaagatcgacgacctgattgcatttctc
aagcagtatgatctgggcggcaagatcaaagaataa

DBGET integrated database retrieval system