KEGG   Brucella suis 1330: BRA0401Help
Entry
BRA0401           CDS       T00096                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bms  Brucella suis 1330
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bms00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BRA0401
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRA0401
  Lipid metabolism
   00071 Fatty acid degradation
    BRA0401
  Amino acid metabolism
   00350 Tyrosine metabolism
    BRA0401
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BRA0401
   00626 Naphthalene degradation
    BRA0401
Enzymes [BR:bms01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BRA0401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:383533..384660
Genome map
AA seq 375 aa AA seqDB search
MKFKAAVLDRHGVERPYNQTKPLVIREIELREPKADEVLVKLAASGLCHSDLSVINGDRS
RQIPMVLGHEAAGVVEKIGEGVTDLVPGDHVVCVFVPNCGHCQPCAEGRPALCEPGAAAN
GKGEMLSGGLRLFCDDGDVYHHCGVSAYAEYAVMSRYSIIRIEKDIPLHIAALMGCAVLT
GTGSIFNTGLVKPGSRVAIAGLGGVGLAAVMGAVAAGATEIIALDMFDDKLALAEQLGAT
KTFNVQSEGVVEAVKEYTKGGVDAAFEYAGSGAALAMCYALTKRGGEVVTAGLPNPKNML
SIPAVSLVAEEKSIRGSYLGSGVPTRDIPLFLDLYRKGKLPVEKLLTHRIKLEEINEGFE
RLAAGKAIRQVVEFN
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaaagccgctgttcttgaccgccatggtgtcgaacgcccctacaaccagacc
aaaccgcttgtcattcgtgaaatcgagcttcgcgaacccaaagccgatgaagttctcgtc
aaactcgccgcttcgggcctgtgccattccgacctttcggttatcaatggcgatcgttcg
cgccagatccccatggttctggggcatgaagctgccggtgtagtggaaaagattggtgag
ggtgtcaccgatctggttcccggcgaccatgttgtttgcgttttcgtgcccaattgcggc
cattgccaaccctgcgccgaggggcggcccgccctgtgcgagccgggcgctgcggcaaac
ggcaagggcgaaatgctttccggcgggcttcgtctcttttgtgatgatggcgatgtctat
catcattgcggcgtttcagcttatgcggaatatgcggtgatgtcgcgttattcgataatc
cgtatcgaaaaggatattccgcttcatattgcagccctgatgggctgtgcggtgctgacc
gggaccggctcgattttcaataccggtctggtgaagcctggcagcagggttgccatcgcc
ggtcttggcggcgtcggccttgcggcggtgatgggcgccgtggccgcaggcgcgacagag
attatcgccctcgacatgttcgatgacaagctggcgcttgccgaacagcttggggccacc
aaaaccttcaatgtccagtctgaaggcgttgtcgaggcggtcaaggaatatacgaagggc
ggcgtcgatgcggcttttgaatatgccggttcgggtgcggcacttgccatgtgctatgcc
ctgacgaagcgcggcggcgaagtggtcacggctggccttccgaacccgaagaacatgctt
tccattcctgctgtcagccttgtggcggaagaaaaatccattcgcggcagctatcttggt
tccggtgtgccgacgcgggatattcctctgtttcttgatctttatcgcaaaggcaaattg
cctgtcgaaaagcttctcacccatcgtatcaagcttgaagaaattaacgagggttttgag
cgccttgctgctggaaaagcaatccggcaggtcgttgaattcaattga

DBGET integrated database retrieval system