KEGG   Brucella suis 1330: BRA0734Help
Entry
BRA0734           CDS       T00096                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bms  Brucella suis 1330
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bms00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BRA0734
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRA0734
  Lipid metabolism
   00071 Fatty acid degradation
    BRA0734
  Amino acid metabolism
   00350 Tyrosine metabolism
    BRA0734
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BRA0734
   00626 Naphthalene degradation
    BRA0734
Enzymes [BR:bms01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BRA0734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:718794..719963
Genome map
AA seq 389 aa AA seqDB search
MTTLTAKWNFPTTVLFGPGHIKELPAVLKAAGIEHPLFVTDPGLAKLPVVASTLAVLDAA
GVQYGVFSDVKPNPVESNLHAGVKVFREGRHDGVIAFGGGSALDLGKLIAFQAGQTRPVW
DFEDIGDWWTRADSNAIAPVIAVPTTAGTGSEVGRAGVLTNESIHTKKVIFHPKMLPVTV
IADPELSTGMPPFITVGTGMDALAHCLEAYCAPGFHPMADGIAVEGIRLVFENLPKAYAN
GGDIEARANMMAAAAMGATAFQKGLGAIHSLSHPIGALYDTHHGMTNAVFMPYVLHHNRA
AIEKRIARLADYLGIEGGFDGFADAIMKLRAELGVPRTLPDLIKNLQMDNARKELIAEMA
VADPTAGGNPVELTKNDALKLLNAALEGR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaccacattgaccgcgaaatggaactttccgaccactgtgcttttcgggccggggcac
atcaaggagcttccagccgtcctgaaagccgcaggcatcgagcacccgcttttcgtcacc
gatccgggcctcgccaaactgcctgtggtcgcctcgacattggccgttctggatgcggcg
ggcgtgcaatatggcgtgttttccgatgtgaaacccaatccggtcgagagcaatcttcat
gccggcgtaaaggttttccgggaaggcaggcatgacggcgtcatcgcctttggcggcggt
tccgcgctcgatctcggcaagctcatcgcctttcaggccggacagacccggcccgtctgg
gattttgaagatatcggcgactggtggacccgcgccgacagcaacgccatagctcccgtc
attgccgtgccgaccaccgcaggcaccggctcggaagtggggcgcgcgggcgttctcacc
aatgaatccatccatacgaagaaggtcatcttccaccccaaaatgctgcccgtaacggtg
atcgccgatcccgaactttccactggcatgccgcccttcatcacggtgggtacgggcatg
gatgcactggcgcactgccttgaagcctattgcgcaccgggcttccatcccatggccgat
ggcattgccgtggagggcatccgccttgtctttgagaacctgcccaaagcctatgccaat
ggcggggatatcgaagcgcgtgccaatatgatggcagccgctgccatgggcgccacggcc
ttccagaagggcctcggtgcgatccattcgctctcgcaccccatcggcgcgctctatgac
acacatcacggcatgaccaatgccgtcttcatgccctatgtgctgcaccacaaccgggct
gccatcgaaaagcgcattgcccggctggccgattatctcggcatcgaaggcgggttcgac
ggctttgccgatgcgatcatgaagctgcgcgccgaacttggcgtgccgcgcaccctgccc
gatctcatcaagaaccttcagatggacaatgcccgcaaggagctgatcgccgaaatggca
gtggcagatcccaccgcaggcggaaacccggttgaacttacaaaaaacgacgcgctaaag
ttgctcaatgcagcattggaaggtagataa

DBGET integrated database retrieval system