KEGG   Brucella suis 1330: BRA0869Help
Entry
BRA0869           CDS       T00096                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bms  Brucella suis 1330
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BRA0869 (tpiA)
   01230 Biosynthesis of amino acids
    BRA0869 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRA0869 (tpiA)
   00051 Fructose and mannose metabolism
    BRA0869 (tpiA)
   00562 Inositol phosphate metabolism
    BRA0869 (tpiA)
Enzymes [BR:bms01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BRA0869 (tpiA)
Exosome [BR:bms04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BRA0869 (tpiA)
  Exosomal proteins of bladder cancer cells
   BRA0869 (tpiA)
  Exosomal proteins of melanoma cells
   BRA0869 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:854527..855297
Genome map
AA seq 256 aa AA seqDB search
MTKFWIGTSWKMNKTLAEARLFAEALKAADAGRSPDIQRFVIPPFTAVREVKEILSGTSV
KVGAQNMHWADQGAWTGEISPLMLKDCNLDIVELGHSERREHFGETNETVGLKVEAAVRH
GLIPLICIGETLEDRESGRAAAVLEEEVRGALSKLSEAQKQAEILFAYEPVWAIGENGIP
ASADYADARQAEIIAVAQSVLARRVPCLYGGSVNPGNCEELIACPHIDGLFIGRSAWNVE
GYLDILARCATKVQAN
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaattctggattggcacaagctggaaaatgaacaagacgctggccgaagcccgc
cttttcgcggaagcgctgaaagccgccgatgcaggccgctcgccagacatccagcgtttt
gtcatcccgcctttcaccgccgtgcgtgaggtgaaggaaatcctctccggcacatccgtg
aaggtcggcgcgcagaacatgcactgggccgatcagggtgcatggaccggcgaaatctcc
ccgctgatgctgaaagattgcaatctcgacattgttgaactgggccattcggagcgccgc
gaacatttcggcgagaccaacgagacggtcggcttgaaagtggaagccgccgtgcgccac
ggcctgatcccgctcatctgcatcggtgaaacgctggaagaccgtgaaagcggacgcgca
gccgcggtgcttgaagaagaagtgcgcggcgcgctttccaagctttccgaggcgcagaag
caggccgaaatcctcttcgcctatgagccagtctgggccatcggcgaaaacggcattccc
gcttccgccgactatgccgatgcgcgacaggccgaaatcatcgcggtggcacaaagcgtg
ctcgctcgccgcgtgccgtgcctttatggcggctcggtcaatccgggcaattgcgaagaa
ctgatcgcctgcccgcatatcgatgggcttttcatcggccgttcggcgtggaacgtcgaa
ggctatctcgacattctggccaggtgcgccaccaaggttcaagcgaattaa

DBGET integrated database retrieval system