KEGG   Brucella suis 1330: BRA0930Help
Entry
BRA0930           CDS       T00096                                 

Gene name
hutH
Definition
histidine ammonia-lyase (EC:4.3.1.3)
Orthology
K01745  
histidine ammonia-lyase [EC:4.3.1.3]
Organism
bms  Brucella suis 1330
Pathway
Histidine metabolism
Metabolic pathways
Module
Histidine degradation, histidine => N-formiminoglutamate => glutamate
Class
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bms00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:916483..918018
Genome map
AA seq 511 aa AA seqDB search
MTIILKPGSVPLETLEKIYREGLPVRIDPAFHAGIEKAAARIAEIAAGDAPVYGINTGFG
KLASIRIAAGDVATLQRNLILSHCCGVGEPLSENIVRLIMALKLVSLGRGASGVRLEVIT
LIEAMLEKGVIPMIPEKGSVGASGDLAPLAHMTAAMIGEGEAFYRGERLSGAKALGKAGL
KPVVLAAKEGLALINGTQTSTALALAGLFRAHRAVRTALITGALSTDAAMGSDAPFHEEI
HQLRGHKGQIDAGRALRTLLEGSAIRRSHLEGDQRVQDPYCIRCQPQVDGACLDILRQAA
RTLEIEANAVTDNPLVLSDGRAVSGGNFHAEPVAFAADQIALAVCEIGAISQRRIALLVD
PSLSFGLPAFLTRKPGLNSGLMIAEVTSAALMSENKQMAHPASVDSTPTSANQEDHVSMA
CHGARRLLQMTANLNAIIGIEALTGALGVELRKPLTTSAELAKVIAALRAKVVTLEEDRY
MADDLKAAAELVADGTLSGVISAGILPDLEA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcatcctcaagcccggttccgtcccgctggagaccctcgaaaaaatctatcgt
gaagggcttcccgtccgcatcgaccctgcattccatgccggtatcgaaaaagctgccgcg
cgcattgcggaaatcgcggcaggagacgcgccggtttacggcatcaataccggtttcgga
aaactcgcctcgatccgtattgcagcgggcgatgtcgccacgcttcaacgcaatctgatc
ctgtcgcattgctgcggcgtcggcgaaccgctttcggaaaatatcgtccgcctcatcatg
gcgctgaagctggtttcgctcgggcgcggcgcgtccggcgtgcggcttgaagtcattacg
cttatcgaggccatgctggaaaaaggtgtgatcccgatgatcccggaaaagggctctgtc
ggcgcttccggcgaccttgcgccacttgcccatatgaccgccgccatgattggcgaaggc
gaagccttttatcggggcgagcgcctctccggcgcaaaggcgctgggaaaggcgggcctg
aagccggtcgtgcttgcagccaaggaagggctggcgcttatcaacggcacccagacctcg
accgcgcttgcacttgcaggtcttttccgcgcccaccgcgcggtacgaaccgcgctcatc
accggcgcattatccaccgatgccgccatgggatcggatgcgcctttccatgaggaaatt
caccagcttcgcggccataagggacagatcgatgcaggccgggcattgcgcaccctgctt
gaagggtctgctatccgccgaagccaccttgaaggcgaccagcgcgtgcaggatccctat
tgcatccgctgccagccgcaggttgacggtgcctgtctcgatattctgcgccaggccgca
cgcacattggaaatcgaagccaatgccgtgaccgacaatccgctcgtgctttcggatggg
cgcgccgtatcgggcggcaatttccatgctgagcctgttgcctttgccgccgaccagatt
gcgcttgcggtttgtgaaatcggcgctatttcgcagcgtcgcatcgcgcttctggttgat
ccctccctctccttcggcctgcccgccttccttacccgcaagccgggccttaattccggc
ctgatgattgccgaggtcacttcggccgcgctgatgagcgaaaacaagcagatggcgcat
ccggcctcggtcgattcaacccccacttccgccaatcaggaagaccacgtttccatggcc
tgccatggcgcgcgccgccttctccagatgaccgccaatctcaatgccattatcggcatt
gaggcgctgaccggcgcgctcggcgtggaattgcgcaagccgctgaccaccagcgcagaa
cttgccaaggtgattgccgccctgcgggccaaggtggtgacactggaagaagaccgctat
atggccgacgacctcaaggccgctgccgaactggtcgccgatggtacgctttcaggcgtc
atttcagcgggcatcctgcccgatctggaggcatga

DBGET integrated database retrieval system