KEGG   Brucella suis 1330: BRA1049Help
Entry
BRA1049           CDS       T00096                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bms  Brucella suis 1330
Pathway
bms00010  Glycolysis / Gluconeogenesis
bms00052  Galactose metabolism
bms00500  Starch and sucrose metabolism
bms00520  Amino sugar and nucleotide sugar metabolism
bms00521  Streptomycin biosynthesis
bms01100  Metabolic pathways
bms01110  Biosynthesis of secondary metabolites
bms01120  Microbial metabolism in diverse environments
bms01130  Biosynthesis of antibiotics
bms01200  Carbon metabolism
Module
bms_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRA1049 (glk)
   00052 Galactose metabolism
    BRA1049 (glk)
   00500 Starch and sucrose metabolism
    BRA1049 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BRA1049 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BRA1049 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BRA1049 (glk)
Enzymes [BR:bms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BRA1049 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AAN34216
UniProt: Q8FV09
Position
II:1032872..1033903
Genome map
AA seq 343 aa AA seqDB search
MQAIIDAEQSFKFPVLVGDIGGTNARFSILVDSNAEPKEFPVLQTADYATIDEAIQHAIL
DQTAIQPRSVILAVAGPVDGDEIDLTNCDWVVRPKKMIADLGFEDVTVLNDFEAQALAVV
SLEGHHMEQIGGKPEEAVATRVVLGPGTGLGVAGLVRTRHAWVPVPGEGGHIDIGPRTER
DYQIFPHIERIEGRVTGEQILSGRGLRNLYLGICAADKITPTLETPVDITSAGLDGSNPQ
AAETLDLFATYLGRLAGDLALIFMAHGGVYLSGGIPVRILSALKAGSFRAAFEDKAPHKA
IMRDIPVRVITYQLAALTGLSAFARTPSRFEVSTEGRRWRMRR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgattatcgacgccgaacagagtttcaagtttccggttctcgtcggcgatatc
ggcggcaccaatgcccgtttttctatcctcgtggattcaaacgcagagccgaaggagttt
cccgtgctccagacggcggattatgccacaatagacgaagcgatccagcacgccattctg
gatcagacggccatccagccgcgctctgtcattctggccgtggcaggcccggtggacggc
gacgagatcgacctcaccaattgcgactgggtcgtgcgtcctaaaaagatgatcgctgat
ctgggctttgaagacgtgaccgtcctcaatgatttcgaggcgcaggcccttgccgtggtt
tcgctggaaggccaccatatggaacagatcggcggcaaaccggaggaggctgttgccacc
cgcgtcgtgctcggccccggcacgggccttggcgtggcaggtctggttcgcacacgtcat
gcatgggttccggttcccggtgaaggcggtcatatcgatatcggtccacgcaccgaacgc
gactaccagattttcccgcatatcgaacgcatcgaagggcgtgtcaccggcgagcaaatt
cttagcgggcggggcctgcgcaacctctatctgggcatctgcgccgccgacaagatcacg
cccacccttgagacgccagtagacattacatccgccggactggacggcagcaatccacaa
gccgcagaaacgcttgacctcttcgccacctatctggggcggcttgcgggcgaccttgcg
ctcattttcatggcgcatggcggcgtttatctttcgggtggcatcccggtgcgcatcctt
tccgccctcaaggccggttcgttccgcgcagccttcgaggacaaggccccgcacaaggcc
atcatgcgcgacataccggtccgcgttatcacatatcaactggcggccttaaccgggctt
tccgctttcgcccgcaccccctcgcgctttgaagtttcgaccgagggccgccgctggcgc
atgcgccgctag

DBGET integrated database retrieval system