KEGG   Brucella suis ATCC 23445: BSUIS_A0034Help
Entry
BSUIS_A0034       CDS       T00638                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bmt  Brucella suis ATCC 23445
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bmt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BSUIS_A0034 (recR)
DNA repair and recombination proteins [BR:bmt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BSUIS_A0034 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(37638..38243)
Genome map
AA seq 201 aa AA seqDB search
MSKRIAGPEIERLIQLLARVPGLGPRSARRAALHLIKKKEALLVPLGGAMQEAAEKVRIC
SCCGNVDTSDPCTICTDERRDPATLIVVEDVSDLWALERAGTMNVRYHVLGGRLSPLDGI
GPDDLNIKGLVERVASGAIKEVILAVNATVEGQTTAHYITDQLSNFDVRVTRLAHGVPVG
GELDYLDEGTLAAALRARTTL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacgaatagccggtcctgaaatcgaacgtctgatccagcttctggcccgcgtg
ccggggctcggaccgcgctcggcccgccgtgcggcgctgcatctcatcaaaaagaaggaa
gcgcttctggtgccgcttggcggcgccatgcaggaggccgctgaaaaggtgcgcatctgt
tcgtgttgcggcaatgtcgatacgtccgacccgtgcacgatctgcaccgatgagcgccgc
gatccggcaactttgattgtcgtggaggatgtatccgatctctgggcgctggagcgggca
ggcacaatgaatgtgcgctatcatgtattgggtggccgcctgtcaccgctcgatggcatc
ggcccggacgatctcaacatcaaggggctggtggagcgggttgcaagcggcgccatcaag
gaagtgatcctcgcggtcaacgccactgtcgaaggccagacgaccgcccattacatcaca
gaccagctatcgaatttcgatgtgcgcgtgacacggcttgcccatggcgttcccgttggc
ggcgaacttgactatctggatgaaggcacgcttgctgctgcgttacgggcgcgaaccacg
ctttaa

DBGET integrated database retrieval system