KEGG   Brucella suis ATCC 23445: BSUIS_A0042Help
Entry
BSUIS_A0042       CDS       T00638                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
bmt  Brucella suis ATCC 23445
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bmt00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BSUIS_A0042
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BSUIS_A0042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:44278..44886
Genome map
AA seq 202 aa AA seqDB search
MNSTRNNKFIMAFLATVFVVMTTGILSDSLFHSPAPEKPGFAIEVAQGSGGGESAAAPAK
EEVSIATLLQSADPARGEVVFKRCQACHTGDKGGANKVGPHLWGVVGRPAASVEGFSYSA
AMKEFGAAGNKWDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNERADLIAYLRTLSDNPVP
LPAADAAPADSDKKPAEAAPAN
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaacccggaataacaaatttattatggcatttctggcaacggttttcgttgtc
atgacgacgggcattctgtctgattcgctgtttcattcgccggctcctgaaaagccgggc
tttgccatagaggtagcccaaggttcggggggcggagaaagtgctgcggctcccgccaag
gaagaagtttcaattgcaaccctgttgcaaagtgccgatccggcgcgtggcgaagtggtt
ttcaagcgttgccaggcttgccacaccggggacaagggcggggccaacaaggttggtccg
catctgtggggtgtcgtgggtcgcccggctgcctccgttgaaggtttcagctattccgct
gccatgaaggaattcggcgcggctggcaacaagtgggattttgagcatctcaacaagttc
ctcacctcgccgaaaggcttcatcaagggtacagccatgggctttgccggtgacaagaag
gataatgagcgcgctgacctgattgcttatctgcgcacgctgtccgacaatccggtgccg
ctgccggccgcagacgcagcgcccgcagatagcgataaaaagcccgccgaagctgcaccg
gccaattga

DBGET integrated database retrieval system