KEGG   Brucella suis ATCC 23445: BSUIS_A0204Help
Entry
BSUIS_A0204       CDS       T00638                                 

Gene name
adhT
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bmt  Brucella suis ATCC 23445
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BSUIS_A0204 (adhT)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSUIS_A0204 (adhT)
  Lipid metabolism
   00071 Fatty acid degradation
    BSUIS_A0204 (adhT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BSUIS_A0204 (adhT)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSUIS_A0204 (adhT)
   00626 Naphthalene degradation
    BSUIS_A0204 (adhT)
Enzymes [BR:bmt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BSUIS_A0204 (adhT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:212303..213337
Genome map
AA seq 344 aa AA seqDB search
MAKTMKAAVVRAFGKPLTIDEVPIPQPGPGQIQVAIQASGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGFVSAVGSGVKHVKEGDRVGIPWLYTACGHCRHCLGGWETLCEEQLNTGYSV
NGGFAEYVVADPNFVGHLPKNIDFNEIAPVLCAGVTVYKGLKVTDTKPGDWVVISGIGGL
GHMAVQYARAMGLNVAAVDIDDRKLDLARRLGATVTVNAKTVADPAAYIRKETDGGAQGV
LVTAVSPKAFEQALGMVARGGTVSLNGLPPGDFPLSIFNMVLNGVTVRGSIVGTRLDLQE
SLDFAADGKVKATIQTGKLEDINAIFDDMRQGNIEGRIVMDLTQ
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagacgatgaaagctgcggtcgtgcgtgccttcggcaaaccgctgacgattgat
gaagtgccgatacctcaacccggtcccggccagattcaggttgccattcaggcttccggc
gtatgccataccgaccttcatgccgccgagggcgattggccggtaaaacccaatccgccc
ttcattccgggtcatgagggtgtcggtttcgtttccgccgtgggcagcggcgtcaagcat
gtcaaggaaggcgaccgtgtcggcattccatggctttacactgcctgcggccattgccgc
cattgccttggtggctgggaaacgctttgcgaggaacagctcaataccggctattccgtc
aatggcggctttgccgaatatgtggtggccgatccgaatttcgtcggccacttgccgaag
aatatcgatttcaacgagattgcgccggtgctctgcgcgggcgtgacggtctataagggc
ctcaaggtcacggatacgaagcccggtgactgggtggtcatttcaggcataggcgggctc
ggccacatggctgtgcaatatgccagggccatggggctgaatgttgccgccgtcgatatt
gacgaccgcaagctcgatctcgcccgcagacttggcgcaaccgttacggtcaacgctaag
acggttgccgacccggcagcctatattcgcaaggaaaccgatggcggtgcgcaaggcgtg
ctggtgacggcggtttcgcccaaggcttttgaacaggcgctgggcatggttgcgcgcggc
ggtactgtttcgctgaatggcctgccgcctggcgatttcccgctttccatcttcaacatg
gtgctcaatggcgtaacggtgcgcggctccatcgtggggacgcggcttgatttgcaggaa
tcgctcgattttgcagccgacggcaaggtcaaggccaccatccaaaccggcaagctggaa
gacatcaacgccatcttcgacgatatgcggcaaggcaatatcgaaggccgcatcgtgatg
gacctgactcaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system