KEGG   Brucella suis ATCC 23445: BSUIS_A0277Help
Entry
BSUIS_A0277       CDS       T00638                                 

Gene name
murA
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bmt  Brucella suis ATCC 23445
Pathway
bmt00520  Amino sugar and nucleotide sugar metabolism
bmt00550  Peptidoglycan biosynthesis
bmt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSUIS_A0277 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSUIS_A0277 (murA)
Enzymes [BR:bmt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BSUIS_A0277 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:bmt01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   BSUIS_A0277 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase GHMP_kinases_C Wyosine_form
Motif
Other DBs
NCBI-ProteinID: ABY37373
UniProt: B0CJN2
Position
I:complement(281098..282387)
Genome map
AA seq 429 aa AA seqDB search
MDRIKIVGGNKLNGVIPISGAKNAALPLMIASLLTDDTLTLENVPHLADVEQLIRILSNH
GVDYSVNGRREHQNGPYSRTIHFTARNIVDTTAPYELVSRMRASFWVIGPLLARMGEANV
SLPGGCAIGTRPVDLLLDALLALGAEIDIENGYAKAKARNGLVGARYKFPKVSVGATHVM
LMAATLAKGETIIENAAREPEVANLADCLNAMGAKISGAGSSTIHVQGVTNLSGARVRII
PDRIEAGTYAMAVAMTGGDVLLEGAQESQLSCVLETLRQAGAEINETNSGLRVVRNGHGI
QPVDITTDPFPGFPTDLQAQFMGLMTRAKGTSHITETIFENRFMHVQELARLGAKISLSG
QTATVEGVERLKGAQVMATDLRASVSLVIAGLAAEGETIVNRVYHLDRGFERLEEKLSRC
GADVKRISG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcattaaaatcgtcggcggcaacaagctcaacggcgtcattcccatttccggc
gctaaaaacgctgcccttcccctgatgatcgcctcgcttctcaccgacgatacgctcacg
ctggaaaacgtgccccatctggccgatgtcgagcaattgatccgcatcctgagcaatcat
ggcgtcgattattccgtgaacggacgtcgcgaacaccagaacggcccctattcccgcacg
atccatttcaccgcccgcaatatcgtggacacgaccgcgccttatgagctcgtttccagg
atgcgcgccagcttctgggttatcggtccgcttctcgcccgcatgggtgaggccaatgtt
tcgctgcccggcggctgcgccatcggcacacgtcccgtggacctgctgcttgatgccctg
ctggcgctcggcgcggaaatcgacattgaaaacggttatgccaaagccaaggccaggaac
ggccttgtcggcgcgcgctataaattccccaaggtttcggtcggcgccacgcatgtcatg
ctgatggcggcaacgctggccaagggcgaaaccatcattgaaaatgccgcacgcgaaccg
gaagtggcaaacctcgccgactgtctcaacgccatgggggcgaagatcagcggcgcgggc
agcagcacgatccatgttcaaggcgtcaccaatctttccggcgcgcgcgtgcgcatcatc
ccggaccgtatcgaggcgggcacctatgccatggccgtggcaatgaccggcggcgatgtt
cttctggaaggtgcgcaggaaagccagctttcctgtgtgcttgaaacgctgcgccaggca
ggcgctgaaatcaacgagaccaatagcggcctgcgcgtggtgcgcaacgggcacggcatc
cagccggtcgatatcaccaccgatcccttccccggcttcccgaccgatcttcaggcgcag
ttcatgggcctgatgacccgcgccaaaggcacctcgcacattaccgagaccatctttgaa
aaccgcttcatgcatgtgcaggaactggcgcgtctgggggcgaaaatctcgctctccggc
cagaccgcaaccgtggagggcgtggaacgcctgaagggcgcgcaggtgatggcgacggac
ctgcgtgcctctgtttcgctggtgatcgcaggacttgcagccgaaggcgaaaccatcgtc
aaccgcgtctatcaccttgatcgcggctttgaacggctggaggaaaagctttcgcgctgc
ggcgcggatgtcaagcgtatcagcggctga

DBGET integrated database retrieval system