KEGG   Brucella suis ATCC 23445: BSUIS_A0576Help
Entry
BSUIS_A0576       CDS       T00638                                 

Gene name
xylA
Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bmt  Brucella suis ATCC 23445
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bmt00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bmt00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(559493..560800)
Genome map
AA seq 435 aa AA seqDB search
MSTGFFGDIQKVRYEGPESDNLLAFRHYNADEIVLGKRMQDHLRFAVAYWHSFAWEGGDP
FGGRTFDRPWFSNEIDAAKLKADVAFEFFSLLGAPYYCFHDADVRPEGRNFAENTRYLNE
IVDIFEKKQAETGMKLLWGTANLFSNRRYMAGAATNPDPDVFAFAAATVKTCIDATKRLG
GENYVLWGGREGYETLLNTDLSRELDHMGRFLSLVVEYKHKIGFKGTILIEPKPQEPTKH
QYDYDVATVYGFLKRYGLENEVKVNIEQGHAILAGHSFEHELALARTLGIFGSIDMNRND
YQSGWDTDQFPNNVPEKALAYYQVLLAGGFTTGGTNFDAKLRRQSLDPQDLLIGHIGGMD
CCARGLKAAARMLEDGALSKPLDERYAGWNGEFGKRLLSGLSLDQIAGEVEAKDINPQPK
SGRQEYLENIVNRYV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgggatttttcggcgatattcagaaggtgcgctatgaggggccggagagcgac
aatctgctggccttccgccattataatgcagatgaaatcgtgctcggcaaacgcatgcaa
gaccatttgcgctttgcggtggcctattggcacagtttcgcctgggagggtggcgatccg
ttcggcgggcgcaccttcgaccggccgtggttttccaacgagatcgatgcggcaaaactc
aaggccgatgtcgcctttgaattcttctccctgctcggcgcaccttattactgcttccac
gatgccgatgtgcggccagagggccgcaattttgcggaaaacacgcgctatctcaatgaa
attgtcgatattttcgagaagaagcaggccgaaaccggcatgaaactgctctggggcacg
gccaatcttttttccaaccggcgctatatggcgggtgcggccacaaatcccgatcctgat
gtcttcgcttttgccgctgcaacagtgaagacctgtatcgacgccaccaagcggctcggt
ggagagaattacgtgctttggggcggtcgcgaaggctatgaaaccctgctcaataccgat
ctttcgcgtgaactcgaccatatgggccggttccttagcctcgtggtggaatacaagcac
aaaatcggcttcaagggcacgatcctgatcgagcccaagccgcaggagccgaccaaacat
cagtatgattacgatgtcgcgacggtttacggcttcctcaagcgttacggtctggaaaac
gaggtgaaggtcaatatcgagcagggccatgccattctggccggtcactcgttcgagcat
gagctggcgcttgcccgcacacttggcattttcggctctatcgacatgaaccgcaacgat
taccaatccggctgggacaccgatcagttcccgaacaatgtgccggagaaggcgctggcc
tattatcaggttctgctggcaggcggcttcacgaccggcggcacgaatttcgacgccaag
ctgcgccgccagtcgcttgatccgcaggatctgctaatcggccatattggcggcatggat
tgctgtgcacgcggactaaaagcagccgcgcggatgcttgaagacggcgctttatccaag
ccgcttgatgagcgttatgcgggctggaacggcgagttcggcaagaggcttctgagcggc
ctttcgctggaccagatcgcgggtgaagtcgaagcgaaagacatcaatccgcagccgaaa
tccggccgtcaggaatatctggaaaacatcgtcaatcgctacgtttga

DBGET integrated database retrieval system