KEGG   Brucella suis ATCC 23445: BSUIS_A0826Help
Entry
BSUIS_A0826       CDS       T00638                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bmt  Brucella suis ATCC 23445
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmt00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BSUIS_A0826 (speB)
Enzymes [BR:bmt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BSUIS_A0826 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(790666..791616)
Genome map
AA seq 316 aa AA seqDB search
MPSKTIDHAITARSLTSAATDPTHAGVLSFMRRTYSKSLKGAEAVVWGIPFDAAVSNRPG
ARFGPQAIRRASAIFDNDPQYPFERDLFENLAVIDYGDCLLDYGNHTKTPSTIEREAAKI
LKSDAFLLTLGGDHFITWPLLKAHAAKYGPLALVQFDAHQDTWFNDGRRIDHGSFVARAV
RDGIIDPDLSIQIGIRTHAPEDCGIRIIYGHEVEDMPAAAIADAILNRTNGRKAYLTFDI
DCLDPAFAPGTGTPVAGGPSSAKMLSVLRKLTALDFVGADVVEVAPAYDHADITAIAGAT
IAMYYLGLLGERKERR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaaagaccatcgaccatgcgatcactgcccgcagcctgaccagtgcggccacc
gacccaacccatgcgggcgtcttgtccttcatgcggcgcacttactccaagtcgctcaaa
ggcgcggaagcagttgtctggggcattcctttcgatgccgccgtttccaaccggcccggc
gcacgcttcggcccgcaggcgatccggcgcgcctcggcgatcttcgacaacgatccgcaa
tatccgttcgagcgtgatcttttcgagaatctcgctgtcatcgattatggcgactgcctg
ctcgactatggcaatcacaccaagacaccctccaccatcgagcgtgaagcagcaaaaatc
ctgaaatccgatgcatttctgctgacgctcggcggcgatcatttcatcacatggccgctt
ctcaaggcccatgccgcaaaatacggccccctcgctctggtgcagttcgatgcgcatcag
gatacatggttcaatgatggcaggcggatcgaccacggctccttcgtggcccgcgcggtg
cgcgacggcatcatcgatcccgacctttcgatccagattggcatccgcacgcatgcgccg
gaagattgcggcatcaggatcatttatggccacgaggtcgaggatatgccagcggcggcg
attgccgatgcaatcctgaaccgcaccaatggcaggaaagcctatctgaccttcgacatt
gactgtctcgatccggcttttgcgccgggaaccggcacgccggttgcaggcggcccctcc
tcggcaaagatgctgtctgtcctgcgcaagctgacggctcttgacttcgtgggcgccgat
gtagtcgaggttgcaccggcctatgaccatgccgatataacagccatcgcgggagcgacg
atcgcaatgtattatctgggccttctgggcgaacggaaagaacgacgatga

DBGET integrated database retrieval system