KEGG   Brucella suis ATCC 23445: BSUIS_A0895Help
Entry
BSUIS_A0895       CDS       T00638                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bmt  Brucella suis ATCC 23445
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmt00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bmt00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:850821..851843
Genome map
AA seq 340 aa AA seqDB search
MNSEIFGYAPDGQVVHRLTISNGPLTAKIINWGAAIQDLRMESHPAPLVIGYRDFADYPA
HSPHLGAIAGRSANRICNARFDLDGTVYEVEPNFLGCHNLHGGSKGLGHHVWKITATGPD
FVSLATVSPDGEMGFPGNLNVNCTYMLNADGTLIVRLEAVTDRPTICNLLHHSYFNLDDG
GEGDVLDHQFKIAGDAYLPVDEALIPDGRVLPVKDTAFDFREFRPLRMQENGRQVAYDNN
FCLAAARGPLRPCASVKAARSGIRLDISTTEPGIQLYAGNTMANDCIGLTGKPYGKHAGF
CLEPQIWPGALEYPYFPQPILRPGDIYAQTSHFTFSREED
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcggaaatcttcggctatgcgccggacgggcaggtggtccaccgcctcactatc
tccaacgggcctttgaccgcaaagatcatcaattggggcgcagccattcaggatctgcgt
atggaaagccacccggcgccactggtgatcggctatcgcgattttgccgattatccggca
cattccccgcatctgggtgcgattgcgggccgctcggccaaccgtatctgcaatgcgcgc
tttgatcttgatggaacggtttacgaggtggagccgaacttccttggctgccacaatctg
catggcggcagcaaggggctcggacaccatgtctggaagatcacggcgaccggccctgat
ttcgtgtcgcttgcaacggtttctcccgatggcgagatgggcttccccggcaatctgaat
gtgaattgcacctatatgctcaatgcggatggaacgctgattgttcggctggaggctgtg
accgacaggccaaccatatgcaatctgcttcaccacagctatttcaatctggatgacggt
ggtgagggtgatgttctcgaccaccaattcaagattgcaggcgacgcctatcttccggtg
gatgaggcgcttattccggacgggcgggttctgccggtaaaggacacggctttcgatttc
cgcgaattcaggccgcttcgtatgcaggaaaacggccgtcaggtggcgtatgacaataat
ttctgccttgcggctgcacgcggcccgctgcgcccctgcgcttcggtaaaggccgcgcgg
tccggcatccggcttgatatttcaactaccgaaccggggatacagctctatgctggcaac
accatggccaatgattgcataggactgacgggcaagccctatggcaaacatgctggcttt
tgccttgaaccacagatatggccgggcgcgctggaatatccttattttccgcagccgatc
ctgcgcccgggcgatatttacgcacagaccagccattttaccttttcgcgcgaagaggat
taa

DBGET integrated database retrieval system