KEGG   Brucella suis ATCC 23445: BSUIS_A1075Help
Entry
BSUIS_A1075       CDS       T00638                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bmt  Brucella suis ATCC 23445
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bmt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSUIS_A1075 (folK)
Enzymes [BR:bmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BSUIS_A1075 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1016675..1017208
Genome map
AA seq 177 aa AA seqDB search
MSTPPKPLRAWLGLGGNIDDPIISMASALRMLDGRSDTRVVSVSPVYRTPPWGKTDQAWF
HNACAQIETALQPLELIAACLDVERSLKRVRLERWGPRIIDIDILVMQDETGRAITMQEP
ALELPHPRMHERAFVLVPLNDIAPSLPVGARTVAEWAADCDRAEMEKARTDAGWWLE
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtgagcactccgccgaaaccattgcgcgcctggcttggcctcggcggcaatatcgatgat
ccgatcatctccatggcgagcgcgcttcgtatgctggatggacggagcgacacgagggtt
gtttccgtatccccggtctaccggaccccgccatggggcaagacggatcaggcctggttc
cacaatgcctgcgcgcaaatcgaaacggccttgcagccactggaactgattgcggcctgt
ctggacgtggagcgatccttgaaacgtgtgcggctggaacggtggggaccacgcatcatc
gatatcgatattcttgttatgcaggatgagacgggcagggcaatcacgatgcaggaaccg
gcattggagcttccgcatccacgtatgcacgagcgagccttcgttctggtgccgctcaat
gatatcgcaccttcgctgcctgtcggtgcgagaactgttgctgaatgggctgccgattgc
gaccgtgcggaaatggaaaaagcccgcacggatgcgggctggtggttggaatag

DBGET integrated database retrieval system