KEGG   Brucella suis ATCC 23445: BSUIS_A1105Help
Entry
BSUIS_A1105       CDS       T00638                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bmt  Brucella suis ATCC 23445
Pathway
bmt00010  Glycolysis / Gluconeogenesis
bmt00071  Fatty acid degradation
bmt00350  Tyrosine metabolism
bmt00625  Chloroalkane and chloroalkene degradation
bmt00626  Naphthalene degradation
bmt01100  Metabolic pathways
bmt01110  Biosynthesis of secondary metabolites
bmt01120  Microbial metabolism in diverse environments
bmt01130  Biosynthesis of antibiotics
bmt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSUIS_A1105
  Lipid metabolism
   00071 Fatty acid degradation
    BSUIS_A1105
  Amino acid metabolism
   00350 Tyrosine metabolism
    BSUIS_A1105
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSUIS_A1105
   00626 Naphthalene degradation
    BSUIS_A1105
Enzymes [BR:bmt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BSUIS_A1105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N_2 ADH_zinc_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ABY38162
UniProt: B0CGL1
Position
I:1051647..1052630
Genome map
AA seq 327 aa AA seqDB search
MKAMVLEKPGQPLVLVERPDPLPGPGQIRLKVEACAVCRTDLHVVDGELERPKLPLVPGH
EIVGVIDAVGTGVDPSRTGRRVGVPWLGHTCGACDYCRSGAENLCDAPLFTGYTRDGGFA
THVVADADFAFDLDEAADPVALAPLLCAGLIGWRSLKKAGEGKRIGLYGFGAAAHIIAQV
CRWQDREVYAFTKPGDTEAKDFARSLGAVWAGDSDILPPSPLDAAIIFAPAGELVPAALR
AVRKGGRVVCGGIHMSDIPSMPYSILWEERALVSVANLTRNDAEEFFPLARAAGVRTHTT
IYPLESANEALADLRSGRLSGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatggtgctggagaagccgggacagccactggttctcgtggagcgccctgat
ccgttgccggggccgggccagatcaggctgaaggttgaagcctgcgccgtctgccggaca
gatttgcatgtggtggatggagagcttgaaaggccaaagctgccgctggttcccggacat
gagatcgttggcgttatcgatgccgttggaacgggcgtcgatccgtcacgcacaggacgg
cgtgtgggggttccgtggcttgggcatacttgcggcgcctgtgactattgtcgctccggc
gctgaaaacctgtgcgatgccccgctttttaccggctacacgcgcgatggcgggttcgcc
acccatgtcgtcgcagatgccgattttgctttcgatctcgatgaggccgccgatcctgtg
gctctggcgcccttgctctgcgctgggctgatcggctggcgatcgctgaagaaagcaggc
gagggcaagcgcatcggcctttatggctttggggctgccgcacacatcattgcgcaggtc
tgccgctggcaggacagggaggtttacgctttcacaaagcccggagatacggaagcgaaa
gattttgcgcgcagccttggcgcggtatgggccggagattcagatattctgccgccgtca
ccgctggatgcagctatcattttcgcacccgccggggagctcgttccagccgccttgcgt
gcggtgcgcaagggcggccgggtggtctgcggcggcatccatatgagcgatattccatcc
atgccctattcgatcctgtgggaagaacgcgcgctcgtttccgtcgcaaacctcacccgg
aacgatgcagaagagtttttcccgcttgcccgcgcggcaggcgtgcgcactcacaccaca
atctacccgcttgaaagtgcaaacgaggcgctcgccgatctgcgctccggccgcctcagc
ggggcggctgttcttgtgccatag

DBGET integrated database retrieval system