KEGG   Brucella suis ATCC 23445: BSUIS_A1105Help
Entry
BSUIS_A1105       CDS       T00638                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bmt  Brucella suis ATCC 23445
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BSUIS_A1105
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSUIS_A1105
  Lipid metabolism
   00071 Fatty acid degradation
    BSUIS_A1105
  Amino acid metabolism
   00350 Tyrosine metabolism
    BSUIS_A1105
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSUIS_A1105
   00626 Naphthalene degradation
    BSUIS_A1105
Enzymes [BR:bmt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BSUIS_A1105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1051647..1052630
Genome map
AA seq 327 aa AA seqDB search
MKAMVLEKPGQPLVLVERPDPLPGPGQIRLKVEACAVCRTDLHVVDGELERPKLPLVPGH
EIVGVIDAVGTGVDPSRTGRRVGVPWLGHTCGACDYCRSGAENLCDAPLFTGYTRDGGFA
THVVADADFAFDLDEAADPVALAPLLCAGLIGWRSLKKAGEGKRIGLYGFGAAAHIIAQV
CRWQDREVYAFTKPGDTEAKDFARSLGAVWAGDSDILPPSPLDAAIIFAPAGELVPAALR
AVRKGGRVVCGGIHMSDIPSMPYSILWEERALVSVANLTRNDAEEFFPLARAAGVRTHTT
IYPLESANEALADLRSGRLSGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatggtgctggagaagccgggacagccactggttctcgtggagcgccctgat
ccgttgccggggccgggccagatcaggctgaaggttgaagcctgcgccgtctgccggaca
gatttgcatgtggtggatggagagcttgaaaggccaaagctgccgctggttcccggacat
gagatcgttggcgttatcgatgccgttggaacgggcgtcgatccgtcacgcacaggacgg
cgtgtgggggttccgtggcttgggcatacttgcggcgcctgtgactattgtcgctccggc
gctgaaaacctgtgcgatgccccgctttttaccggctacacgcgcgatggcgggttcgcc
acccatgtcgtcgcagatgccgattttgctttcgatctcgatgaggccgccgatcctgtg
gctctggcgcccttgctctgcgctgggctgatcggctggcgatcgctgaagaaagcaggc
gagggcaagcgcatcggcctttatggctttggggctgccgcacacatcattgcgcaggtc
tgccgctggcaggacagggaggtttacgctttcacaaagcccggagatacggaagcgaaa
gattttgcgcgcagccttggcgcggtatgggccggagattcagatattctgccgccgtca
ccgctggatgcagctatcattttcgcacccgccggggagctcgttccagccgccttgcgt
gcggtgcgcaagggcggccgggtggtctgcggcggcatccatatgagcgatattccatcc
atgccctattcgatcctgtgggaagaacgcgcgctcgtttccgtcgcaaacctcacccgg
aacgatgcagaagagtttttcccgcttgcccgcgcggcaggcgtgcgcactcacaccaca
atctacccgcttgaaagtgcaaacgaggcgctcgccgatctgcgctccggccgcctcagc
ggggcggctgttcttgtgccatag

DBGET integrated database retrieval system