KEGG   Brucella suis ATCC 23445: BSUIS_A1189Help
Entry
BSUIS_A1189       CDS       T00638                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bmt  Brucella suis ATCC 23445
Pathway
bmt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmt01100  Metabolic pathways
bmt01110  Biosynthesis of secondary metabolites
bmt01130  Biosynthesis of antibiotics
bmt01230  Biosynthesis of amino acids
Module
bmt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bmt00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSUIS_A1189 (trpC)
Enzymes [BR:bmt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BSUIS_A1189 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ABY38240
UniProt: B0CGT9
Position
I:1139387..1140193
Genome map
AA seq 268 aa AA seqDB search
MSTDILRKIEAYKREEIAAAKARVALDELKARTRDQSAPRGFLKALEAKRAAGQFALIAE
IKKASPSKGLIRPDFDPPALAKAYEEGGAACLSVLTDTPSFQGAPEFLTAARQACSLPAL
RKDFLFDPYQVYEARSWGADCILIIMASVDDDLAKELEDTAFALGMDALIEVHDEAEMER
ALKLSSRLLGVNNRNLRSFEVNLAVSERLAKMAPSDRLLVGESGIFTHEDCLRLEKSGIG
TFLIGESLMRQHDVAAATRALLTGAEKL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgatattcttcgcaagatcgaagcctataagcgggaagaaatagccgccgcc
aaggcgcgtgttgcccttgatgaactgaaggcccggacgagggatcagtcagcgccgcgc
ggttttctgaaggcacttgaggccaagcgcgccgccggtcaatttgcactgatcgcggag
ataaagaaagcaagcccgtccaaaggcttgatccgccccgatttcgacccgccagcgctt
gcaaaggcttatgaagaaggcggtgcggcctgtctttccgtgctgaccgacacgccttcc
tttcagggcgcgccggaattcctcacggccgcacgccaggcttgcagcctgcccgcattg
cgcaaggatttcctgttcgacccctatcaggtctatgaagcgcgtagctggggagcggat
tgcattctcatcatcatggccagcgtcgatgacgatcttgcaaaagagctggaagacacg
gctttcgcactgggcatggatgcgctgatcgaagtgcatgacgaagctgaaatggaacgc
gccctgaagctttcctcgcgcctgctcggcgtcaacaatcgcaatctgcgcagcttcgag
gtcaatctcgccgtttccgagcggcttgcgaaaatggctccgtccgaccgtctgctggtt
ggcgaaagcggcatcttcacgcatgaggactgcctgcggcttgaaaagtccggcatcggc
acttttctgataggcgaaagccttatgcgacaacatgacgttgcggcagccacccgcgcg
cttttgacgggtgcggaaaagctatga

DBGET integrated database retrieval system