KEGG   Brucella suis ATCC 23445: BSUIS_A1449Help
Entry
BSUIS_A1449       CDS       T00638                                 

Definition
dihydrofolate reductase type 3
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bmt  Brucella suis ATCC 23445
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bmt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSUIS_A1449
   00670 One carbon pool by folate
    BSUIS_A1449
Enzymes [BR:bmt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BSUIS_A1449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1373160..1373678)
Genome map
AA seq 172 aa AA seqDB search
MKKPLVSIVVAASENNVIGQENDMPWRLSTDLKRFKALTLGKPVIMGRRTWQSLGRPLPG
RANIVITRDADFRAEGAEVVGSLEDALALARKFAAEGGVDEICVIGGGQIYVQAMPLADR
LHLTRVLSVIEGDTYFPEINPQDWQLLSSEDVPAGDKDSYPTRYMLYERRVS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaccactcgtttccatcgtcgtggcggcctccgaaaacaatgtgatcgggcag
gaaaacgatatgccatggcgtctttccaccgacctgaagcggttcaaggcgctgactttg
ggcaagccggtcatcatggggcggcgcacctggcagtcgcttggccgtcccctgccgggg
cgggccaatatcgtcattacccgtgatgccgatttccgggcagaaggtgccgaggtggtc
ggttcgctggaggatgcgctagcgcttgcgcgcaagtttgcggcggaaggcggggtggac
gaaatctgtgtgatcggcgggggacaaatctatgtacaggccatgccgcttgccgatcgc
ttacacctgacgcgcgttctctctgtcatcgaaggcgatacatattttcctgaaatcaat
ccgcaggactggcaattgctttcgagcgaggatgtgcccgccggtgacaaagacagctat
ccaacacgctatatgctgtacgaaaggcgcgtttcgtaa

DBGET integrated database retrieval system