KEGG   Brucella suis ATCC 23445: BSUIS_A1743Help
Entry
BSUIS_A1743       CDS       T00638                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bmt  Brucella suis ATCC 23445
Pathway
bmt00020  Citrate cycle (TCA cycle)
bmt00190  Oxidative phosphorylation
bmt00650  Butanoate metabolism
bmt01100  Metabolic pathways
bmt01110  Biosynthesis of secondary metabolites
bmt01120  Microbial metabolism in diverse environments
bmt01130  Biosynthesis of antibiotics
bmt01200  Carbon metabolism
Module
bmt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bmt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bmt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSUIS_A1743 (sdhD)
   00650 Butanoate metabolism
    BSUIS_A1743 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BSUIS_A1743 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Ribophorin_II
Motif
Other DBs
NCBI-ProteinID: ABY38760
UniProt: B0CIF4
Position
I:complement(1654612..1655007)
Genome map
AA seq 131 aa AA seqDB search
MNGMNNDMRTPLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEV
RAALSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLAC
VFAILKLSFGG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcatgaataacgatatgcgtactccgctcgggaaggttcgcggtctgggttcg
gcaaaagaaggcaccagccatttctggtatcagcgcctgagcgccgttgccctggtgccg
ctggttctgtttttcatcggcctggtcatttcgctcaatggcgcaagctatgcagaagtc
cgggctgccctgtcacatcccttcaccgctgtggtgatggcgctgtttgtcctcacgggc
gtttatcacatgcgcctgggtatgcaggttattattgaagattatgtgcatggcgaaggc
atgaagatcgtgctggtgatgctgaacaccttctttacggtggtggttggtcttgcctgc
gttttcgcgatcctcaagctcagctttggaggttga

DBGET integrated database retrieval system