KEGG   Brucella suis ATCC 23445: BSUIS_A1950Help
Entry
BSUIS_A1950       CDS       T00638                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bmt  Brucella suis ATCC 23445
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bmt01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bmt00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bmt00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1851184..1852404)
Genome map
AA seq 406 aa AA seqDB search
MNKPVAPNSYKTGPDEEGMFGIFGGRFVAETLMPLILELQQAYETAKNDPEFKAELNALS
TFYAGRPSKLYYAEGLSKHLGGAKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIA
ETGAGQHGVASATIAARFGLPCIVYMGATDVERQKPNVFRMKLLGAEVKPVSAGNGTLKD
AMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEARQQILEQEGRLPDVIV
AAVGGGSNAIGLFHPFLDDASVKIVGVEAGGRGLEGEEHCASMSAGRPSVLHGNRTYLLQ
NADGQILEGHSVSAGLDYPGVGPEHSWLKDSGRVDYVPILDNEALDAFQLCTRTEGIIPA
LESAHAIAQAVKMAPTMGKDKVMIVNLSGRGDKDVHTVGKLLGMDI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaagccggttgcacccaattcctacaagacgggccctgacgaagagggcatgttc
ggcatattcggtggccgcttcgtcgccgaaacgctgatgcctctgatcctcgaattgcag
caggcttatgaaacggcgaagaatgaccccgaattcaaggcggagttgaacgccctttcc
accttttatgccggccgtccttccaagctctattatgccgaaggcctgagcaaacatctg
ggtggcgctaaaatctacttcaagcgcgaagacctgaaccataccggcagccacaagatc
aacaattgccttggccagatcctgcttgccaagcgcatgggcaagacgcgcatcatcgca
gaaacgggcgccggtcagcatggcgtggcgtctgccaccattgccgcacgcttcggcctg
ccctgtatcgtctatatgggcgcaaccgacgtggagcgccagaagcccaatgttttccgc
atgaagctgctcggcgcggaagtgaagccggtttctgccggcaatggcacgctgaaagac
gcgatgaacgaagccctgcgtgactgggttacgaatgtcgaggatacctattacctgatc
ggcacggctgccggtccgcacccctatcccgaactggtgcgcgatttccaatccgtcatc
ggcaccgaagcgcgccagcagatactcgaacaggaaggccgcctgccagatgtgatcgtg
gcagcggtcggcggcggctccaacgccattggcctgttccatccgttcctcgacgacgcc
tcggtgaagatcgtcggtgtcgaagcaggcggacgcggtcttgagggagaggaacattgc
gcttcgatgagcgcaggccgccccagcgttctgcatggcaaccgcacctatctcctccag
aacgcggatggccaaattctggaaggccattcggtttccgctggtctcgactatccgggc
gtcgggcccgagcattcgtggctgaaggacagcgggcgcgtcgactatgtgccgatcctc
gacaatgaggcgctggatgcattccagctttgcacccgcaccgaaggcatcatcccggcg
ctcgaatccgcccatgccattgcgcaggccgtcaaaatggcgccgacaatgggcaaggac
aaggtgatgatcgtcaatctgtccggccgcggcgacaaggacgtccacacggtcggcaag
cttctcggcatggatatctga

DBGET integrated database retrieval system