KEGG   Brucella suis ATCC 23445: BSUIS_B0050Help
Entry
BSUIS_B0050       CDS       T00638                                 

Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bmt  Brucella suis ATCC 23445
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bmt00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(42221..43216)
Genome map
AA seq 331 aa AA seqDB search
MSELLFETDANPIPSRIRGGLFHAPDGKALRYALLKAESRPCRGTVIVLQGRNEFIENYY
ETMSDLAGRGFTVATFDWRGQGGSHRLLRDRLRGYVRSFNDYADDLDHFLTGIVLPDCPP
PFFILAHSAGALVALSSLERLSSRITRMVLCAPLMGLGGQKISDDNVRRITAALRWIGLG
RIYAAGGRTLSAARAFADNPLTSDPLRFMRNVEITRTYTDLALGGPTVRWVWSALETAWR
INQPDFYKSPIAPVLIIAAGADRVVSTAVIERFVARTRNISLAVIDGARHEMLQEADFYR
EQVLAAFDAFIPGSSPVESMPQSLEPDLSQI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaactgctttttgaaaccgatgcaaatccgatcccgagccgaataagaggcggt
cttttccatgcgccggacgggaaggccctgcgctacgccctgctgaaagccgaaagccgg
ccgtgccggggcacggtcatcgtgcttcagggccgcaacgaattcatcgaaaattattat
gaaaccatgtccgacctcgccgggcgcggttttaccgttgccaccttcgactggcgcggc
cagggcggctcgcatcgcctgctgcgcgaccgcctgcgcggctatgtgcgcagcttcaac
gattatgccgacgatctcgaccatttcctgaccggaatcgtgctgcccgactgcccgccg
ccatttttcattctcgctcactcggcaggtgcgctggtcgcgctttcctcactggaacgg
ctctcctcccgcatcacccgcatggtgctttgcgcgcccctgatggggcttggcgggcag
aaaatcagcgatgacaatgtgcgccgcattaccgccgcgctgcgctggatcggcctgggg
agaatctatgcggcaggcgggcgcaccctgtcggcggcgcgcgcctttgccgacaatcca
ctgaccagtgatccgttacggttcatgcgcaatgtggaaatcacacggacttatacggac
ctcgcgcttggcggccccaccgtgcgctgggtctggagcgcactggaaaccgcatggcgc
atcaaccagccggatttttacaaaagccccatcgcgccggttctgattatcgcggctggt
gctgaccgcgttgtttcaacagcggtgatcgagcgtttcgtggcgcgcacgcgaaacatc
tcgctcgccgttattgacggtgcgcgccacgaaatgctccaggaagcagatttctaccgc
gaacaggtgctggcggctttcgacgccttcatccccggctcatcgccggtggaatccatg
ccccaaagtcttgaacccgacctctctcaaatctaa

DBGET integrated database retrieval system