KEGG   Brucella suis ATCC 23445: BSUIS_B0177Help
Entry
BSUIS_B0177       CDS       T00638                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
bmt  Brucella suis ATCC 23445
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bmt00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bmt02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:160362..160757
Genome map
AA seq 131 aa AA seqDB search
MRAAMTAISAIAASLLISTVAQGADIESGKKIFNACKACHQIGEGAKNMVGPELNGLFGR
HSGSVEGYKYSDANKNSGIVWDEEIFRKYIKKPREVIPKTKMVYAGLKDEGKIDDLIAFL
KQYDLGGKIKE
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctgcaatgaccgcgatttccgcaatcgcagcttcccttttgatctcgactgtc
gcgcaaggggcggatatcgaatccggcaagaagattttcaacgcatgcaaggcttgccat
cagattggtgagggggcgaaaaatatggtcggccctgagctcaacgggctctttgggcgt
cactcgggttccgtcgaaggatataagtattccgacgcaaacaagaattccggaattgtc
tgggatgaggaaattttccgcaaatacatcaagaagccgcgtgaagtgatcccgaagacc
aagatggtctatgctggcttgaaggatgagggaaagatcgacgacctgattgcatttctt
aagcagtatgatctgggcggcaagatcaaggaataa

DBGET integrated database retrieval system