KEGG   Brucella suis ATCC 23445: BSUIS_B0390Help
Entry
BSUIS_B0390       CDS       T00638                                 

Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
bmt  Brucella suis ATCC 23445
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSUIS_B0390
Enzymes [BR:bmt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     BSUIS_B0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(366685..369063)
Genome map
AA seq 792 aa AA seqDB search
MSTVPAKGPLTPQQLSLINRYWRAANYLSVGQIYLMKNPLLREPLQPEHIKPRLLGHWGT
TPGLNFIYAHLNRIIQQRNANVIYICGPGHGGPGMVANTYLEGTYSEIYPAISEDEAGME
RLFRQFSFPGGIPSHAAPETPGSIHEGGELGYALVHAYGAAFDNPDLVVACVVGDGEAET
GALATSWHSNKFLNPARDGAVLPILHLNGYKIANPTVLTRLSDDDLDNLFRGYGYEPFFV
EGSEPADMHQKMAATLDTIFQRIQDIKKNADVHSPERPRWPMIILRSPKGWTGPKTVDGL
VVENYWRAHQVPVANCRENDAHRKILEDWMKSYDPSDLFDEKGALKPELRALAPKGEARI
GANPHANGGLLRKELHMPDFRQYAVNVTEPGAIEAQSTKILGDFLRDVMKLNETEKNFRI
FGPDETASNRLGSVLEATNRVWMAETLDMDDHLAADGRVMEVLSEHLCQGWLEGYLLSGR
HGFFSCYEAFIHIIDSMFNQHAKWLQVARELEWRKPISSLNYLLTSHVWRQDHNGFSHQD
PGFVDLVANKSADIVRVYFPPDANTLLWVGDHCLKTWNRVNVIVAGKQPEPQWLTMAEAE
KHCEAGLAIWEWAGTEDGLEPDIVMACAGDVPTMETLAAVDLLRQSLPHLRIRVVNVVDL
MVLQSPHQHPHGISDEEFDRMFTTNRPVIFAYHGYPYLIHRLVYKRTNHSNFHVRGFIEQ
GTTTTPFDMTVLNELDRFHLAMEAVERLPLGESVAKPLIDNFTEKLALHKDYIRQHGEDM
PEIRDWKWTWPR
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgtgccagcaaaagggcctctcacaccgcagcagctttcactcatcaaccgt
tactggcgcgcggcgaattatctttccgtcggccagatttatctgatgaaaaatcccctg
ttgcgcgaaccgctccagcctgagcacatcaagccgcggcttctcggccattggggcacg
acacccggcctcaatttcatctatgcgcatctcaaccgcattattcagcagcgcaacgcc
aatgtgatctatatttgcggccccggccatggcgggccgggcatggtggccaacacctat
ctggagggcacctattccgaaatctatcccgcaatcagcgaagatgaagcgggcatggaa
aggctcttccgccagttttccttccccggcggaataccaagccatgccgcgccggaaaca
ccgggctctatccacgaagggggcgaactgggttatgcgctcgtccacgcctatggtgcg
gccttcgacaatcccgatctggtggtggcctgcgtcgtgggcgacggagaagcggaaacc
ggcgcacttgcaacttcgtggcactccaacaaattcctcaatccggcgcgcgatggtgcg
gttctgccgatcctgcatctcaatggctacaagatcgccaaccccaccgtgctgacccgc
ctttcggatgatgatctggacaatcttttccgtggctacggttatgagcctttctttgtt
gaaggcagcgagcctgccgacatgcaccagaagatggccgcaacactggacacgattttc
cagcgcattcaggacatcaagaaaaatgccgatgtgcactcgcccgagcgcccgcgctgg
ccgatgattattctcagaagcccgaagggctggaccggcccaaaaaccgtggacggtctg
gttgttgaaaactattggcgcgcccatcaggtgccggttgccaattgccgcgaaaacgat
gcccatcgcaaaatcctcgaagactggatgaagagttacgacccgtccgatctgttcgac
gaaaaaggggcgctgaagcctgaattgcgggcgctggcgccaaagggtgaagcgcgcata
ggggccaatccgcatgccaatggcgggctcttgcgtaaagagcttcacatgccggatttc
cgccaatatgcggtcaatgtcaccgaaccgggagcgatagaagcgcaatcaaccaaaata
ttgggcgattttctgcgcgatgtgatgaaactgaacgagacggaaaagaacttccgcatc
ttcggccccgacgaaaccgcctccaacaggctcggcagcgtattagaggcgacgaaccgg
gtctggatggccgaaacgctggacatggatgaccacctcgccgccgacgggcgtgtaatg
gaggttctcagcgaacatctctgccagggctggcttgaaggctatcttctcagtggccgg
cacggcttcttttcctgctacgaagccttcatccacattatcgattccatgttcaaccaa
catgccaaatggttgcaggttgcgcgcgaactggaatggcgcaagcccatctcatcgctc
aattatctgctgacctcccatgtctggcggcaggaccataacggcttctcccatcaggat
cccggcttcgtcgatctcgtcgccaacaaaagcgccgatatcgtgcgtgtctatttcccg
ccggatgccaacacccttttgtgggtgggagatcactgcctgaaaacctggaaccgcgtg
aatgtcatcgtggcgggcaagcagccggaaccgcaatggctgaccatggcggaggctgag
aaacattgcgaagcaggtctcgccatatgggaatgggcgggcacggaagacgggctggag
ccggatatcgtcatggcctgcgcgggcgatgtgccgaccatggaaacgcttgccgcggtt
gatcttctgcgccagtccctgccgcatctgcgcattcgcgtggtgaatgtggttgacctc
atggtgctgcaatcgccgcatcagcacccgcatggcatttccgatgaggaattcgaccgg
atgttcaccaccaacaggcccgtcatcttcgcctatcacggctatccttatctcatccat
cgactggtctataagcgcaccaaccactccaatttccacgttcgtggttttatcgagcag
ggaacgaccacaacgcctttcgacatgaccgtgctgaacgagctggatcgtttccacctc
gcgatggaagccgtcgagcgcctgccgctgggcgaaagcgttgccaaacccctgatcgac
aatttcacggagaaacttgcgctgcataaggactatatccgacagcatggtgaggacatg
ccggaaatccgcgactggaaatggacatggccgcgataa

DBGET integrated database retrieval system