KEGG   Brucella suis ATCC 23445: BSUIS_B0438Help
Entry
BSUIS_B0438       CDS       T00638                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bmt  Brucella suis ATCC 23445
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:bmt00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bmt00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(426370..426894)
Genome map
AA seq 174 aa AA seqDB search
MHFTPLNINGAWSIEPERLKDERGWFARVYCEAAFAERKLETHFPQHSLSFSREKGTLRG
LHYQNEPHSETKLVTCLQGIVWDVLVDLRPHSPTYRRWAGVELSAENGVQLYIPEGCAHG
FQTLTDDVLIRYMISKPYAPDHAAGIRYDDPALDIPWPEKPSVISQKDLGWPFL
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcactccgctcaacatcaacggcgcatggtccatcgagccggaacggctgaag
gacgagcgcggctggttcgcgcgggtctattgcgaggcggcctttgccgaacggaagctg
gaaacacactttccccagcacagcctttccttctcgcgcgagaagggaaccctgcgcgga
ctgcattatcagaacgagccgcatagcgagacgaaactcgtcacctgcctgcaaggcatc
gtctgggatgtgctggtggatcttcgcccccactcacccacttatcggcggtgggcgggg
gtggaactttcagccgaaaacggtgtgcaactctatataccggaaggctgcgcccacggt
ttccagacgctgacggatgatgtcctcatccgctacatgatctcgaagccctatgcgccc
gatcatgccgccggcatccgctatgacgatccagccctcgacattccatggccggagaag
cccagcgtcatttcgcaaaaagatcttggctggccgtttctttga

DBGET integrated database retrieval system