KEGG   Brucella suis ATCC 23445: BSUIS_B0451Help
Entry
BSUIS_B0451       CDS       T00638                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bmt  Brucella suis ATCC 23445
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BSUIS_B0451
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSUIS_B0451
   00620 Pyruvate metabolism
    BSUIS_B0451
   00640 Propanoate metabolism
    BSUIS_B0451
  Energy metabolism
   00680 Methane metabolism
    BSUIS_B0451
Enzymes [BR:bmt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BSUIS_B0451
Lipid biosynthesis proteins [BR:bmt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BSUIS_B0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(439182..440852)
Genome map
AA seq 556 aa AA seqDB search
MTESPASARLDRYDDAVAQFDIAKAIALLAGNPDTGINACIECCDRYTGENRVALRAISI
DNTLTELTFEDLRDMSARVGNMLADAGISAGDVVAGLLPRTPELVATILGAWRIGAIYQP
LFTAFGPKAIEQRFGTSGAKLVVTNLANRSKLAEVENCPRVATILAPGESLPEGDIDFRA
AVAAASTECEPVMRKGSDLFMMMSTSGTAGLPKGVPVPLRALMAFGAYMRDAVGLRSDDI
FWNIADPGWAYGLYYAVTGPLLLGVPTILNEGGFTAENTYDIIERLGVTSLAGSPTAFRL
LMAAGPESAARVKGRLRVVSSAGEPLNPEVIRWFDACLGAPIHDHYAQTELGMVVNNHHG
LEHPVRQGSAGYAMPGYRVAVLDEAGKEVDPNEPGVLAIDIDNSPLLWFTGYYKKDTPSI
SGGYYRTGDTVEFEPDGSISFIGRADDVITSSGYRIGPFDVESALLEHPAVNEAAVVGVP
DPQRTEIVKAFVILAPGFEGTPELAEELALHVKKQLSAHTYPRQIDFVAELPKTPSGKIQ
RFLLRKAEVEKQQQQN
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaagccctgcttcagcacggctcgaccgctacgatgatgccgttgcgcagttc
gatattgcaaaagccattgcgcttcttgcaggaaatcctgatacgggtatcaatgcctgc
attgaatgctgcgaccgatatacgggcgaaaatcgcgtggcgctgcgcgccatttccatc
gacaatacgttgactgaactcacctttgaagacctgcgcgatatgtccgcgcgggtcggc
aatatgctggccgatgccgggatcagcgcaggcgatgtggttgccggtcttctcccccgc
acgcctgaactcgtcgccaccattctcggcgcctggcgcatcggcgcaatctatcagccg
cttttcaccgccttcggcccaaaagccatcgaacagcgtttcggcaccagtggcgccaaa
ctcgtcgtcaccaacctggccaatcgttccaaattggccgaagtggaaaactgcccccgc
gtcgcaaccattcttgcccccggtgaaagcctgccggaaggcgatatcgactttcgcgca
gccgtggcggcagcatcgaccgaatgcgagcccgtcatgcgcaagggcagcgaccttttc
atgatgatgtccacctccggcacggcgggcctgcccaaaggcgtcccggtgccgctgcgc
gccctgatggctttcggcgcctatatgcgcgatgccgtgggcctgcgcagcgacgatatt
ttctggaatatcgccgatccgggctgggcatatgggctttactatgccgtgacgggtccc
ctgcttctgggtgtgccgacgatcctgaacgaaggcggtttcaccgccgaaaacacctat
gacatcatcgaacgcctcggcgtgacgagccttgcgggctctccgactgccttccgcctg
cttatggccgccgggccggaatctgctgcccgcgtcaagggccgcttgcgcgtggtatcc
agcgcgggcgagccgctgaacccggaagtcattcgctggttcgatgcctgtcttggcgcg
ccgatccacgatcattacgcccagacggaactgggcatggtggtgaacaaccatcatgga
ttggaacatccggtgcggcagggttcggcgggctatgccatgccgggctacagggttgcg
gttctggatgaagcgggcaaagaagtcgaccccaatgaaccgggcgttctggccattgat
atcgacaattcgccgcttctctggttcaccggctattataaaaaggatacgccctccatc
tccggcggatattatcgcaccggcgatacggtggaattcgagccggatgggtctatcagc
ttcatcggccgcgccgatgacgtcatcacctcctccggctatcgcatcgggcctttcgat
gtggaaagcgcgcttctggaacatcctgcggtcaacgaggctgcggtggtcggcgttccc
gatccgcaacgcaccgaaatcgtgaaggcctttgtcatcctggcccccggcttcgagggt
acgccggaactggcggaagaactggcgcttcacgtcaagaaacagctttccgcccatacc
tatccgcggcagatcgactttgtggcggagcttcccaagacgccgagcggaaaaatacag
cgcttcctcctgcgcaaggcggaagtcgaaaagcaacagcaacagaattag

DBGET integrated database retrieval system