KEGG   Brucella suis ATCC 23445: BSUIS_B0451Help
Entry
BSUIS_B0451       CDS       T00638                                 

Definition
(GenBank) Hypothetical protein, conserved
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bmt  Brucella suis ATCC 23445
Pathway
bmt00010  Glycolysis / Gluconeogenesis
bmt00620  Pyruvate metabolism
bmt00640  Propanoate metabolism
bmt00680  Methane metabolism
bmt01100  Metabolic pathways
bmt01110  Biosynthesis of secondary metabolites
bmt01120  Microbial metabolism in diverse environments
bmt01130  Biosynthesis of antibiotics
bmt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSUIS_B0451
   00620 Pyruvate metabolism
    BSUIS_B0451
   00640 Propanoate metabolism
    BSUIS_B0451
  Energy metabolism
   00680 Methane metabolism
    BSUIS_B0451
Enzymes [BR:bmt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BSUIS_B0451
Lipid biosynthesis proteins [BR:bmt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BSUIS_B0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABY39449
UniProt: A9WYD3
Position
II:complement(439182..440852)
Genome map
AA seq 556 aa AA seqDB search
MTESPASARLDRYDDAVAQFDIAKAIALLAGNPDTGINACIECCDRYTGENRVALRAISI
DNTLTELTFEDLRDMSARVGNMLADAGISAGDVVAGLLPRTPELVATILGAWRIGAIYQP
LFTAFGPKAIEQRFGTSGAKLVVTNLANRSKLAEVENCPRVATILAPGESLPEGDIDFRA
AVAAASTECEPVMRKGSDLFMMMSTSGTAGLPKGVPVPLRALMAFGAYMRDAVGLRSDDI
FWNIADPGWAYGLYYAVTGPLLLGVPTILNEGGFTAENTYDIIERLGVTSLAGSPTAFRL
LMAAGPESAARVKGRLRVVSSAGEPLNPEVIRWFDACLGAPIHDHYAQTELGMVVNNHHG
LEHPVRQGSAGYAMPGYRVAVLDEAGKEVDPNEPGVLAIDIDNSPLLWFTGYYKKDTPSI
SGGYYRTGDTVEFEPDGSISFIGRADDVITSSGYRIGPFDVESALLEHPAVNEAAVVGVP
DPQRTEIVKAFVILAPGFEGTPELAEELALHVKKQLSAHTYPRQIDFVAELPKTPSGKIQ
RFLLRKAEVEKQQQQN
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaagccctgcttcagcacggctcgaccgctacgatgatgccgttgcgcagttc
gatattgcaaaagccattgcgcttcttgcaggaaatcctgatacgggtatcaatgcctgc
attgaatgctgcgaccgatatacgggcgaaaatcgcgtggcgctgcgcgccatttccatc
gacaatacgttgactgaactcacctttgaagacctgcgcgatatgtccgcgcgggtcggc
aatatgctggccgatgccgggatcagcgcaggcgatgtggttgccggtcttctcccccgc
acgcctgaactcgtcgccaccattctcggcgcctggcgcatcggcgcaatctatcagccg
cttttcaccgccttcggcccaaaagccatcgaacagcgtttcggcaccagtggcgccaaa
ctcgtcgtcaccaacctggccaatcgttccaaattggccgaagtggaaaactgcccccgc
gtcgcaaccattcttgcccccggtgaaagcctgccggaaggcgatatcgactttcgcgca
gccgtggcggcagcatcgaccgaatgcgagcccgtcatgcgcaagggcagcgaccttttc
atgatgatgtccacctccggcacggcgggcctgcccaaaggcgtcccggtgccgctgcgc
gccctgatggctttcggcgcctatatgcgcgatgccgtgggcctgcgcagcgacgatatt
ttctggaatatcgccgatccgggctgggcatatgggctttactatgccgtgacgggtccc
ctgcttctgggtgtgccgacgatcctgaacgaaggcggtttcaccgccgaaaacacctat
gacatcatcgaacgcctcggcgtgacgagccttgcgggctctccgactgccttccgcctg
cttatggccgccgggccggaatctgctgcccgcgtcaagggccgcttgcgcgtggtatcc
agcgcgggcgagccgctgaacccggaagtcattcgctggttcgatgcctgtcttggcgcg
ccgatccacgatcattacgcccagacggaactgggcatggtggtgaacaaccatcatgga
ttggaacatccggtgcggcagggttcggcgggctatgccatgccgggctacagggttgcg
gttctggatgaagcgggcaaagaagtcgaccccaatgaaccgggcgttctggccattgat
atcgacaattcgccgcttctctggttcaccggctattataaaaaggatacgccctccatc
tccggcggatattatcgcaccggcgatacggtggaattcgagccggatgggtctatcagc
ttcatcggccgcgccgatgacgtcatcacctcctccggctatcgcatcgggcctttcgat
gtggaaagcgcgcttctggaacatcctgcggtcaacgaggctgcggtggtcggcgttccc
gatccgcaacgcaccgaaatcgtgaaggcctttgtcatcctggcccccggcttcgagggt
acgccggaactggcggaagaactggcgcttcacgtcaagaaacagctttccgcccatacc
tatccgcggcagatcgactttgtggcggagcttcccaagacgccgagcggaaaaatacag
cgcttcctcctgcgcaaggcggaagtcgaaaagcaacagcaacagaattag

DBGET integrated database retrieval system