KEGG   Brucella suis ATCC 23445: BSUIS_B1255Help
Entry
BSUIS_B1255       CDS       T00638                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bmt  Brucella suis ATCC 23445
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bmt00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bmt00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1215837..1216628
Genome map
AA seq 263 aa AA seqDB search
MTDVSARKTAIVTGSNSGIGLGIAHALAAAGHNVVINSFTDRDEDHALARMLAEEHGANV
IYIAADMSKAEDCRNLIAKTVKVFGNSDILVNNAGIQHVAPVEEFPPEQWDRIIAINLTS
AFHTSAAAIPHMRKAGWGRIINIASAHGLVASPFKSAYVAAKHGIVGFTKTLALELATAK
ITANSICPGYVLTPLVEAQIPDQMKAHHMDRETVIRDVMLDKQPTKEFVTTAQIGAVATF
LASDAAAQINGAAISVDGGWTAE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtatccgcccgcaaaactgcaattgttaccggatcaaattcagggatcggc
ctcggaatcgcccatgcactggcagccgcggggcataacgtcgtaataaactccttcacc
gaccgcgacgaagaccatgcgcttgcccggatgcttgccgaagaacatggtgcgaatgtc
atctatattgccgcggatatgtcgaaagccgaagattgccgcaatctcattgccaaaacc
gtcaaggttttcggcaactccgatattctggtcaataatgcgggcatccagcatgtcgcc
ccggtggaagagtttcctcccgagcaatgggaccgcatcatcgcaatcaacctgacatcg
gccttccacacttctgctgctgccatcccccatatgcgaaaggcgggctggggccgtatc
atcaatattgcctcggcgcatggtctcgtggcttcgccgttcaaatcggcatatgtcgcc
gccaagcacggcattgtcggcttcaccaagacgctggcgctggagcttgccaccgcaaaa
atcaccgccaattccatctgtcccggctatgtgctgacccctctggtggaagcgcagata
cccgaccagatgaaagcccaccacatggaccgtgaaaccgtgatccgcgacgtgatgctg
gataaacagccgacgaaggagtttgtcaccaccgcgcaaatcggggccgttgccactttc
ctcgcaagcgatgcggcagcgcagatcaacggtgcagccatttccgtcgacggcggctgg
acggcagaataa

DBGET integrated database retrieval system