KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_0279Help
Entry
Bmul_0279         CDS       T00624                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bmul_0279
Enzymes [BR:bmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Bmul_0279
Exosome [BR:bmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bmul_0279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(305718..306716)
Genome map
AA seq 332 aa AA seqDB search
MSFHPLHRPRRMRRDDFSRRLMRENRLTTDDLIYPVFVVEGTNERQPVPSMPGVERVSVD
LLMQVAEQCVELGVPVLSLFPAIEPALKTPDGREAGNPEGLIPRAVRELKKRFPELGVLT
DVALDPYTSHGQDGVLDENGYVINDDTIEILIEQARAQAEAGVDIVAPSDMMDGRIGAIR
EMLESDGHIHTRIMAYSAKFASAFYGPFRDAVGSASNLGKGNKMTYQMDPANSDEALREV
RLDIDEGADMVMVKPGMPYLDIVRRVKDEFRFPTYVYQVSGEYAMLKAAAMNGWLDHDKV
VLESLLAFKRAGADGVLTYFALDAARLLKAQR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagtttccatccgcttcatcgtccgcgccggatgcgccgcgacgatttctcccggcgc
ctgatgcgcgaaaaccgcctgaccaccgacgatctgatctaccccgtgttcgtcgtcgaa
ggcacgaacgagcggcagcccgtgccgtcgatgcccggcgtcgagcgcgtatcggtcgat
ctgctgatgcaggtggccgagcagtgcgtcgaactgggcgtgccggtgctgtcgctgttc
cccgcgatcgagccggcgctgaagacgccggacggccgcgaggcgggcaaccccgaaggc
ttgattccgcgcgcggtgcgtgaactcaagaagcgcttccccgaactcggcgtgctgacc
gacgtcgcgctcgatccgtacacgagccacggccaggacggcgtgctcgacgagaacggc
tatgtgatcaacgacgatacgatcgagatcctgatcgagcaggcgcgcgcgcaggccgaa
gccggcgtcgacatcgtcgcgccgtcggacatgatggatgggcgcatcggcgcgattcgc
gagatgctcgaaagcgacgggcatatccatacgcgcatcatggcgtactcggccaagttc
gcgtccgcgttctacggcccgttccgcgatgcggtcggctcggcgtccaatctcggcaag
ggcaacaagatgacctaccagatggatcccgcgaacagcgacgaagcgctgcgcgaagtg
cgcctcgacatcgacgaaggcgcggacatggtgatggtcaagcccggcatgccgtatctc
gacatcgtgcgccgcgtgaaggacgaattccgctttccgacctacgtctatcaggtgagc
ggcgaatacgcgatgctgaaggccgccgcgatgaacggctggctcgaccacgacaaggtc
gtgctcgaatcgctgctcgcgttcaagcgcgcgggcgccgacggcgtgctcacatacttc
gcgctcgatgccgcgcgtctgctgaaagcgcaacgctga

DBGET integrated database retrieval system