KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_0279Help
Entry
Bmul_0279         CDS       T00624                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00860  Porphyrin and chlorophyll metabolism
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bmul_0279
Enzymes [BR:bmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Bmul_0279
Exosome [BR:bmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bmul_0279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABX13974
UniProt: A0A0H3KI72
Position
1:complement(305718..306716)
Genome map
AA seq 332 aa AA seqDB search
MSFHPLHRPRRMRRDDFSRRLMRENRLTTDDLIYPVFVVEGTNERQPVPSMPGVERVSVD
LLMQVAEQCVELGVPVLSLFPAIEPALKTPDGREAGNPEGLIPRAVRELKKRFPELGVLT
DVALDPYTSHGQDGVLDENGYVINDDTIEILIEQARAQAEAGVDIVAPSDMMDGRIGAIR
EMLESDGHIHTRIMAYSAKFASAFYGPFRDAVGSASNLGKGNKMTYQMDPANSDEALREV
RLDIDEGADMVMVKPGMPYLDIVRRVKDEFRFPTYVYQVSGEYAMLKAAAMNGWLDHDKV
VLESLLAFKRAGADGVLTYFALDAARLLKAQR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagtttccatccgcttcatcgtccgcgccggatgcgccgcgacgatttctcccggcgc
ctgatgcgcgaaaaccgcctgaccaccgacgatctgatctaccccgtgttcgtcgtcgaa
ggcacgaacgagcggcagcccgtgccgtcgatgcccggcgtcgagcgcgtatcggtcgat
ctgctgatgcaggtggccgagcagtgcgtcgaactgggcgtgccggtgctgtcgctgttc
cccgcgatcgagccggcgctgaagacgccggacggccgcgaggcgggcaaccccgaaggc
ttgattccgcgcgcggtgcgtgaactcaagaagcgcttccccgaactcggcgtgctgacc
gacgtcgcgctcgatccgtacacgagccacggccaggacggcgtgctcgacgagaacggc
tatgtgatcaacgacgatacgatcgagatcctgatcgagcaggcgcgcgcgcaggccgaa
gccggcgtcgacatcgtcgcgccgtcggacatgatggatgggcgcatcggcgcgattcgc
gagatgctcgaaagcgacgggcatatccatacgcgcatcatggcgtactcggccaagttc
gcgtccgcgttctacggcccgttccgcgatgcggtcggctcggcgtccaatctcggcaag
ggcaacaagatgacctaccagatggatcccgcgaacagcgacgaagcgctgcgcgaagtg
cgcctcgacatcgacgaaggcgcggacatggtgatggtcaagcccggcatgccgtatctc
gacatcgtgcgccgcgtgaaggacgaattccgctttccgacctacgtctatcaggtgagc
ggcgaatacgcgatgctgaaggccgccgcgatgaacggctggctcgaccacgacaaggtc
gtgctcgaatcgctgctcgcgttcaagcgcgcgggcgccgacggcgtgctcacatacttc
gcgctcgatgccgcgcgtctgctgaaagcgcaacgctga

DBGET integrated database retrieval system