KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_0326Help
Entry
Bmul_0326         CDS       T00624                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bmu00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bmu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:357403..358752
Genome map
AA seq 449 aa AA seqDB search
MQVTVNERDAVQSVATAHPAANGETQGQGMDKLVIEGGRRLAGEIVVSGAKNAALPILCA
GLLSAEPVHLDNVPNLQDVRTTLKVLGQMGVKSETDGCRVQLDASRVDNLVAPYELVKTM
RASILVLGPLLARFGEAKVSLPGGCAIGARPVDQHIKGLQAMGAEISIEHGFIEARAKRL
KGARIVTDMITVTGTENLLMAATLADGETVIENAAREPEVSDLAHLLVAMGAKIDGIGTD
RLVIQGVERLHGAHHAVIPDRIEAGTFLCAVAAAGGDVTLTGVRPHILDAVIDKLREAGV
TVEEGDRWLRVKMDRRPNAVTIRTSEYPAFPTDMQAQFMALNSVATGTAQVVETIFENRF
MHVQELNRLGANITVDGNTALVTGVDKLSGANVMATDLRASASLVIAGLRAEGETRVDRI
YHLDRGYDRMEAKLTAVGANVRRVSGSQA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagtcaccgtcaacgagcgcgacgccgtgcagagcgtcgcgacggcacacccggcc
gccaacggggaaacgcaggggcaggggatggacaagctcgtgatcgaaggcggccgccgg
ctcgcgggcgagatcgtcgtgtcgggcgcgaagaatgcggcgctgccgattctgtgcgcg
gggctgctgagcgccgagcccgtgcacctcgacaacgtgccgaatctgcaggacgtacgc
accacgctgaaggtgctcggccagatgggcgtgaagagcgagaccgacggctgccgcgtg
cagctcgacgcgtcgcgcgtcgacaacctcgtcgcgccgtacgagctcgtgaagacgatg
cgcgcgtcgatcctcgtgctcggcccgctgctcgcgcgcttcggcgaggcgaaggtatcg
ctgcccggcggctgcgcgatcggtgcgcggcccgtcgaccagcacatcaaggggctgcag
gcgatgggcgccgagatcagcatcgagcacggcttcatcgaggcgcgcgcgaagcgtctg
aagggcgcgcgcatcgtgaccgacatgatcaccgtgacgggcaccgaaaacctgctgatg
gccgccacgctcgccgacggcgagaccgtgatcgaaaacgcggcgcgcgaaccggaagtg
agcgatctcgcacacttgctggtcgcgatgggcgcgaaaatcgacggcatcggcaccgac
cgcctcgtgatccagggcgtcgagcgcctgcacggcgcgcaccacgcggtgattccggac
cgcatcgaggccggcacgttcctgtgcgcggtcgcggcggcgggcggcgacgtgacgctg
accggcgtgcgtccgcacatcctcgacgcggtgatcgacaagctccgtgaagccggcgtg
acggtcgaggaaggcgatcgctggctgcgcgtgaagatggatcgccggccgaacgcggtg
acgatccgcacgtccgaatacccggcgtttccgaccgacatgcaggcacagttcatggcg
ctcaattcggtggcgaccggtaccgcgcaggtcgtcgaaacgatcttcgagaaccgcttc
atgcacgtgcaggagctgaaccgcctcggcgcgaacatcacggtcgacggcaatacggcg
ctcgtgaccggcgttgacaagctgtcgggcgcgaacgtgatggcgaccgatctgcgcgcg
tccgcgagcctcgtgatcgccgggctgcgcgccgaaggcgagacgcgcgtcgaccgcatc
tatcacctcgatcgcggctacgaccgcatggaagccaaactgaccgccgtcggcgcgaac
gtgcgccgcgtctccgggagccaagcatga

DBGET integrated database retrieval system