KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_0446Help
Entry
Bmul_0446         CDS       T00624                                 

Definition
(GenBank) phosphoglycerate mutase 1 family (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bmul_0446
   01230 Biosynthesis of amino acids
    Bmul_0446
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmul_0446
  Energy metabolism
   00680 Methane metabolism
    Bmul_0446
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bmul_0446
Enzymes [BR:bmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bmul_0446
Exosome [BR:bmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bmul_0446
  Exosomal proteins of melanoma cells
   Bmul_0446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
1:complement(491822..492634)
Genome map
AA seq 270 aa AA seqDB search
MADPAAGPARRAPLPSLPTARSMYKLVLIRHGESTWNKENRFTGWVDVDLTEQGRNEAYQ
AGELLKEAGYTFDIAYTSVLKRAIRTLWHVQDRMDLMYLPVVHSWRLNERHYGALSGLNK
AETAAKFGDDQVLVWRRSYDTPPPALEPTDERAPYNDPRYAKVPREQLPLTECLKDTVAR
VLPLWNESIAPAIRAGKQVLIAAHGNSLRALIKYLDGISDSDIVGLNIPNGVPLVYELDE
NLKPIKHYYLGDQEAIAKAQAAVAKQGKAG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcggacccggctgcgggccccgcgcgacgcgcaccgcttccttcactaccgaccgca
agatccatgtacaaactcgttctcatccgccacggcgaatcgacgtggaacaaggaaaac
cgcttcaccggctgggtcgacgtcgacctcaccgaacagggtcgcaacgaggcctatcag
gccggcgaactgctcaaggaagccggctacacgttcgacatcgcgtacacgtcggtgctc
aagcgcgcgatccgcacgctgtggcacgtgcaggaccggatggatctcatgtatctgccg
gtcgtccattcgtggcgactgaacgagcgccactacggtgcgctgtcgggcctgaacaag
gctgaaacggccgccaagttcggcgacgaccaggtgctcgtctggcgccgcagctacgac
acgccgccgcccgcgctggaaccgaccgacgagcgcgcgccgtacaacgatccgcgctac
gcgaaggtgccgcgcgagcagctgccgctcaccgagtgcctgaaggacacggtcgcccgc
gtgctgccgctctggaacgagtcgatcgcgccggcgatccgcgcgggcaagcaggtgctg
atcgcggcgcatggcaattcgctgcgcgcgctcatcaagtacctcgacggcatctcggac
agcgacatcgtcggcctgaacatcccgaacggcgtgccgctcgtctacgaactcgacgag
aacctgaagccgatcaagcactattacctcggcgaccaggaagcgatcgcgaaggcgcag
gccgcggtcgcgaagcagggcaaggcgggctga

DBGET integrated database retrieval system