KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_0514Help
Entry
Bmul_0514         CDS       T00624                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00900  Terpenoid backbone biosynthesis
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01130  Biosynthesis of antibiotics
Module
bmu_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bmul_0514
Enzymes [BR:bmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Bmul_0514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABX14209
UniProt: A9AEY9
Position
1:complement(562893..563774)
Genome map
AA seq 293 aa AA seqDB search
MTDSTRSLRNCLAPAKLNLFLHITGRRPNGYHDLQSVFQLLNWGDTLHFTLRDDGKVARA
TDVPGVPEQSDLVVRAANLLKAHTGTAAGVDIEIDKCLPMGAGLGGGSSDAATTLLALNR
LWQLDLPRAELQSLAVKLGADVPFFVFGKNAFAEGIGEELAEVELPTRWFLVVTPRVHVP
TAEIFSDELLTRDSKPVTITDFLAQQSSDARWPDSFGRNDMQQVVTSKYAEVAQVVKWLY
NVAPARMTGSGASVFAAFQSKQQAEAAKAQLPAGWNGAVAESLNEHPLFAFAS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcgacccgctcgctgcgcaactgtcttgcgcccgcgaaactcaacctgttc
ctgcatatcaccggccgccggccgaacggctatcacgacctgcagagcgtgtttcagctg
ctgaactggggcgatacgctgcacttcacgctgcgcgacgacggcaaggtcgcgcgtgcg
accgacgtgccgggcgtgcccgagcagagcgatctcgtcgtacgcgcggcgaacctgctg
aaggcgcacacgggcaccgccgcaggcgtcgacatcgagatcgacaaatgcctgccgatg
ggcgccggactcggcggcggcagctccgatgccgcgacgacgctgcttgcgctgaaccgt
ctatggcagctcgatctgccgcgcgcggaattgcagtcgctcgcggtaaaactcggcgcc
gacgtgccatttttcgtttttggaaaaaatgcgttcgcagagggtatcggagaagaatta
gctgaggtagaattgccgactcgctggttcctggttgtgacgccacgcgttcatgtcccg
accgctgaaattttttcagatgagttgttgacaagagattcgaagccagtcacaattacg
gactttcttgcacagcaaagcagcgatgcgagatggccagacagtttcggccggaacgac
atgcagcaagttgtgacaagcaagtacgcggaagttgcgcaggtggtcaaatggttgtat
aatgtggcccccgcgaggatgaccggctccggagcaagcgtgtttgcagcgtttcaaagc
aaacagcaggcagaagcggcgaaagcccagttgcccgccggctggaacggcgcagttgcc
gagagcctgaacgagcatccgctcttcgctttcgcgtcatga

DBGET integrated database retrieval system