KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_0543Help
Entry
Bmul_0543         CDS       T00624                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00071  Fatty acid degradation
bmu00072  Synthesis and degradation of ketone bodies
bmu00280  Valine, leucine and isoleucine degradation
bmu00310  Lysine degradation
bmu00362  Benzoate degradation
bmu00380  Tryptophan metabolism
bmu00620  Pyruvate metabolism
bmu00630  Glyoxylate and dicarboxylate metabolism
bmu00640  Propanoate metabolism
bmu00650  Butanoate metabolism
bmu00900  Terpenoid backbone biosynthesis
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01120  Microbial metabolism in diverse environments
bmu01130  Biosynthesis of antibiotics
bmu01200  Carbon metabolism
bmu01212  Fatty acid metabolism
bmu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bmul_0543
   00630 Glyoxylate and dicarboxylate metabolism
    Bmul_0543
   00640 Propanoate metabolism
    Bmul_0543
   00650 Butanoate metabolism
    Bmul_0543
  Lipid metabolism
   00071 Fatty acid degradation
    Bmul_0543
   00072 Synthesis and degradation of ketone bodies
    Bmul_0543
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bmul_0543
   00310 Lysine degradation
    Bmul_0543
   00380 Tryptophan metabolism
    Bmul_0543
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bmul_0543
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bmul_0543
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bmul_0543
Enzymes [BR:bmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bmul_0543
Exosome [BR:bmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bmul_0543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III CMD
Motif
Other DBs
NCBI-ProteinID: ABX14238
UniProt: A0A0H3KHY9
Position
1:593367..594548
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAARTAVGKFGGSLAKVAAPELGATVIRAALERAGVKPDQVSEVIMGQVLTAG
SGQNPARQSLIKAGLPSAVPGMTINKVCGSGLKAVMLAANAIVAGDAEIVVAGGQENMSA
APHVLPGSRDGFRMGDAKLVDTMIVDGLWDVYNQYHMGITAENVAKEYGITREEQDAFAA
LSQNKAEAAQKAGRFNDEIVPVSIPQRKGEPLQFATDEFVRHGVTAESLAGLKPAFAKDG
TVTAANASGINDGAAAVLVMSAQKAQALGLTPLARIKAYANAGVDPRVMGMGPVPASRRC
LERAGWTPGDLDLMEINEAFAAQALAVHKQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMVKRDAKRGLASLCIGGGMGVALAVERD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgtagtgatcgtatcggccgcgcggaccgcggtcggcaaattcggcggctcg
ctggcgaaggtggcggcgcccgaactgggcgcgacggtgatccgcgcggcgctggagcgc
gcgggcgtgaagccggaccaggtcagcgaagtgatcatggggcaggtgttgaccgcgggt
tcgggccagaacccggcacgccagtcgctgatcaaggccggactgccgagcgcggtgccg
gggatgacgatcaacaaggtgtgtggctcggggctgaaggccgtgatgctggccgcgaac
gcgatcgtcgcgggcgacgcggagatcgtcgtggcgggcgggcaggagaacatgagcgcg
gcgccgcacgtgctgccgggctcgcgcgacgggttccggatgggcgacgcgaagctggtc
gacacgatgatcgtcgacggcctctgggacgtgtacaaccagtaccacatgggcatcacg
gcggagaacgtcgcgaaggaatacggcatcacgcgcgaagagcaggatgcattcgcggcg
ctgtcgcagaacaaggccgaagcggcgcagaaggcggggcgcttcaatgacgagatcgtg
ccggtgtcgattccgcagcgcaagggcgagccgctgcagttcgcgaccgacgagttcgtg
cgtcatggcgtgacggcggagtcgctagcgggcctgaagccggcgttcgcgaaggacggc
acggtgacggcggccaacgcgtcgggtatcaacgacggcgcggcggcggtgctcgtgatg
tcggcgcagaaggcccaggcgctgggcctgacgccgctcgcgcggatcaaggcctatgcg
aacgcgggcgtggatccgcgcgtgatggggatgggcccggtgccggcgtcgcgtcgatgc
ctggagcgcgcgggctggacgccaggcgatctggatctgatggagatcaacgaggcgttt
gcggcgcaggcgctggcggtgcacaagcagatgggctgggacacgtcgaaggtgaacgtg
aacggcggggcgatcgcgatcggtcacccgatcggcgcatcgggctgccggatcctggtg
acgctgctgcacgagatggtcaagcgcgatgcgaagcgcgggctcgcgtcgctctgcatc
ggcggcgggatgggcgtcgcgctggcggtcgaacgagattag

DBGET integrated database retrieval system