KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_0597Help
Entry
Bmul_0597         CDS       T00624                                 

Gene name
glyS
Definition
glycyl-tRNA synthetase subunit beta (EC:6.1.1.14)
Orthology
K01879  
glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Bmul_0597 (glyS)
Enzymes [BR:bmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     Bmul_0597 (glyS)
Amino acid related enzymes [BR:bmu01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   Bmul_0597 (glyS)
Transfer RNA biogenesis [BR:bmu03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Bmul_0597 (glyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(651955..654054)
Genome map
AA seq 699 aa AA seqDB search
MTHNHPAPLLVELLTEELPPKALARLGDAFAEGLAQRLAARDLVEGELVFERYATPRRLA
VVVQNVRAVAPDRQVREKVLPVSVALDAQGNPTAPLAKKLAALGRPNLTIAELERAQDGK
AEAFFINYSAAGATLADGLQAALDETLAKLPIPKVMTYQRPDGSDVQFVRPVHRLTVLHD
DRVVPVTAFGIDAGDTTLGHRFLSDGLVAIQHASAYAETLRDKGRVIAHFGDRKETIRTQ
LNEHANGDTVVMPDALLDEVTSLVEWPVVYPCRFEDEFLQVPQECLILTMQTNQKYFALT
DIGGKLRSRFLIVSNIETKTPGEIVEGNERVVRPRLADAKFFFEQDKKKPLAARVPLLAN
VVYHNKLGSALARVERLEALAGEIAPAIGADVAHAKRAARLAKADLLTDMVGEFPELQGT
MGTYYARHDGEPDDVALACAEHYQPRFSGDTLPTTPVSTAVALADKLETIVGIWGIGLAP
TGEKDPFALRRHALGVLRLLIEKQLPLDLVSLLRTAYARFEGVPGVAESTDAIVAFFMDR
LRGLLRERGYSAGEVDAVLSLNPTRLDDLVARLDAVREFTRLAEAEALAAANKRISNILK
KSEGGANGAVQPTLLVEAAEKALHEQLAAVTPHVQSQLEARAYTGALSALAALRAPVDTF
FNDVMVNADDPALRANRLALLSALHQQMNCVADISKLAA
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacaatcatcccgcccccctcctcgtcgagctgctgaccgaagagctgccgccg
aaggccctcgcgcgcctcggcgacgcatttgccgaaggcctcgcgcaacgcctcgccgcg
cgcgatctcgtcgaaggcgagctcgtgttcgaacgctatgcgacgccgcgccgcctcgcg
gtcgtcgtgcagaacgtgcgcgcggtcgcaccggaccgccaggtccgcgaaaaggtgctg
ccggtgtcggtcgcactcgacgcgcaaggcaatccgaccgccccgctcgcgaagaaactc
gcggcgctcggccgtccgaacctgacgatcgccgagctcgagcgcgcacaggacggcaag
gccgaagcgttcttcatcaactattcggccgccggcgcgacgctcgccgacgggctgcag
gccgcgctcgacgagacgctcgcgaagctgccgatcccgaaggtcatgacctatcagcgc
ccggacggcagcgacgtgcagttcgtgcgtcccgtgcatcggctgacggtgctgcacgac
gatcgcgtcgtgcccgtcaccgcgttcggcatcgacgccggcgacacgacgctcggccat
cgcttcctgtccgacgggctcgtcgcgatccagcatgcgagcgcgtacgccgagacgctg
cgcgacaagggccgcgtgatcgcgcatttcggcgatcgcaaggaaacgatccgcacgcag
ctgaacgagcatgcgaacggcgacacggtcgtgatgcccgatgcgctgctcgacgaagtg
acgtcgctcgtcgaatggccggtcgtctatccgtgccgcttcgaggacgaattcctgcag
gtgccgcaggaatgcctgatcctcacgatgcagacgaaccagaagtatttcgcgctgacc
gacatcggcggcaagctgcgctcgcgcttcctgatcgtgtcgaacatcgagacgaagacg
ccgggcgaaatcgtcgagggcaacgagcgcgtcgtgcgtccgcgcctcgccgatgcgaag
ttcttcttcgagcaggacaagaagaagccgctcgccgcgcgcgtgccgctgctcgcgaac
gtcgtctatcacaacaagctcggctcggcgctggcgcgcgtcgagcgcctcgaagcgctg
gccggcgagatcgcgcccgcgatcggcgccgacgtcgcgcatgcgaagcgcgccgcgcgc
ctcgcgaaggccgacctgctgaccgacatggtcggcgagttcccggaactgcagggcacg
atgggcacgtactacgcgcgccacgacggcgagcccgacgacgtcgcgctcgcgtgcgcc
gagcactaccagccgcgcttctcgggcgacacgctgccgaccacgccggtgtcgacggcc
gtcgcgctcgcggacaagctcgaaacgatcgtcggcatctggggcatcggcctcgcgccg
accggcgagaaggatccgttcgcgctgcgccgccacgcgctcggcgtgctgcgcctgctg
atcgagaagcagctgccgctcgacctcgtgtcgctgctgcgtaccgcctacgcgcgcttc
gaaggcgtgccgggcgttgcggaatcgaccgacgcgatcgtcgcgttcttcatggaccgc
ctgcgcggcctgctgcgcgagcgcggctactcggccggcgaagtcgacgcggtgctgagc
ctgaacccgacgcgcctcgacgatctcgtcgcgcgcctcgacgcggtgcgcgaattcacg
cgtctcgcggaagccgaagcgctcgcggccgcgaacaagcggatctcgaacatcctgaag
aaatcggaaggcggcgcgaacggcgccgtgcagccgacgctgctcgtcgaggcggccgag
aaggcgctgcacgaacagctcgcggccgtgacgccgcacgtgcagtcgcagctcgaggca
cgcgcgtacacgggcgcgctgtcggcgctcgccgcgctgcgtgcgccggtcgatacgttc
ttcaacgacgtgatggtcaacgccgacgatccggcgctgcgcgcgaaccgtctggcgctg
ctgtccgccctgcatcagcagatgaactgcgtcgccgacatctcgaagctcgccgcataa

DBGET integrated database retrieval system