KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_0653Help
Entry
Bmul_0653         CDS       T00624                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00020  Citrate cycle (TCA cycle)
bmu00640  Propanoate metabolism
bmu00660  C5-Branched dibasic acid metabolism
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01120  Microbial metabolism in diverse environments
bmu01130  Biosynthesis of antibiotics
bmu01200  Carbon metabolism
Module
bmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bmul_0653
   00640 Propanoate metabolism
    Bmul_0653
   00660 C5-Branched dibasic acid metabolism
    Bmul_0653
Enzymes [BR:bmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bmul_0653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABX14348
UniProt: A9AFT3
Position
1:716912..718078
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEELGGPVWVVKAQIHAGGRGKGGGV
KVAKSLEQVREYANQILGMQLVTHQTGPEGQKVNRLLIEEGADIKQELYVSLVVDRISQK
IVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDSQADDLATKIGVPAASIPQARAI
LQGLYKAFWETDASLAEINPLNVSGDGKVVALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPGLKAILVNIFGGIMRCDVIAEGVIAGSKAVNLNVPLVVRMKGTNEDLGKKM
LADSGLPIISADSMEEAAQKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggagtcgcggtaccg
cgcggcaagccggcgttctcggtggacgaggccgtcaaggtggcggaagagctcggtggc
ccggtgtgggtcgtcaaggctcagattcacgcgggtggccgcggcaagggcggcggcgtg
aaggtcgcgaagtcgctcgagcaggtgcgcgaatacgcgaaccagatcctcggcatgcag
ctggtcacgcaccagacgggcccggaaggccagaaggtgaaccgcctgctgatcgaagaa
ggcgccgacatcaagcaggaactgtatgtcagcctcgtcgtcgaccgcatctcgcagaag
atcgtgctgatgggttcgagcgaaggcggcatggacatcgaagaagtcgccgaaaagcac
ccggaactgatccacaaggtcatcgtcgagccgtcgacgggcctgctcgactcgcaggca
gacgacctcgccacgaagatcggcgtgccggctgcttcgattccgcaagcacgcgcgatc
ctgcaaggcctgtacaaggcattctgggaaaccgacgcatcgctggctgaaatcaacccg
ctgaacgtttccggcgacggcaaggtcgtcgcactcgacgcgaagttcaacttcgactcg
aacgcgctgttccgtcacccggaaatcgtcgcgtaccgcgatctggacgaagaagatccg
gctgaaatcgaagcgtcgaagttcgacctcgcgtacatctcgctcgacggcaacatcggc
tgcctcgtgaacggcgcaggcctcgcgatggcgacgatggacacgatcaagctgttcggc
ggcgaaccggcgaacttcctggacgtcggcggtggcgcgacgaccgagaaggtcaccgaa
gcgttcaagctgatgctgaagaacccgggtctgaaggcgatcctcgtgaacatcttcggc
ggcatcatgcgctgcgacgtgatcgcggaaggcgtgatcgccggttcgaaggccgtgaac
ctgaacgtgccgctcgtcgtgcgcatgaagggcacgaacgaggacctgggcaagaagatg
ctggccgattccggcctgccgatcatctcggcggacagcatggaagaggctgcgcagaag
gtggtcgcggctgccgcaggcaagtaa

DBGET integrated database retrieval system