KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_1026Help
Entry
Bmul_1026         CDS       T00624                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00010  Glycolysis / Gluconeogenesis
bmu00051  Fructose and mannose metabolism
bmu00562  Inositol phosphate metabolism
bmu00710  Carbon fixation in photosynthetic organisms
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01120  Microbial metabolism in diverse environments
bmu01130  Biosynthesis of antibiotics
bmu01200  Carbon metabolism
bmu01230  Biosynthesis of amino acids
Module
bmu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bmu_M00002  Glycolysis, core module involving three-carbon compounds
bmu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmul_1026
   00051 Fructose and mannose metabolism
    Bmul_1026
   00562 Inositol phosphate metabolism
    Bmul_1026
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bmul_1026
Enzymes [BR:bmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bmul_1026
Exosome [BR:bmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bmul_1026
  Exosomal proteins of bladder cancer cells
   Bmul_1026
  Exosomal proteins of melanoma cells
   Bmul_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABX14717
UniProt: A0A0H3KGB6
Position
1:1123107..1123862
Genome map
AA seq 251 aa AA seqDB search
MSKQRTKRVIGNWKMHGRLAGNQALLNEVVQGAGAAAADTAIGVCVPFPYLAQVQAQLGG
SRIAWGAQDVSAHEQGAFTGEVAAAMVAEFGACYAIVGHSERRAYHGERNETVAAKTQRA
LAAGLTPVVCVGETLEQRESGATEQVVGAQLDAVLAVLSADEAARIVVAYEPVWAIGTGK
SATSAQAQDVHAFLRARLAAKGAADVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKA
EDFLAICRAAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacagagaacaaagcgggtgatcggcaactggaagatgcacggccggctggcc
ggcaaccaggcgttgctgaacgaagtggtacagggcgcgggcgccgcggcggccgacacg
gcgatcggcgtgtgcgtgccgttcccgtatctcgcgcaggttcaggcgcagctcggcggc
agccgtatcgcatggggcgcgcaggacgtgtcggcacacgagcagggcgcgtttaccggc
gaagtcgcggcggcgatggttgccgaattcggtgcgtgctacgcgatcgtcggtcactcg
gagcgccgcgcgtatcacggcgagcgcaacgagacggtcgcggcgaagacgcagcgtgcg
cttgccgcggggctgacgcccgtcgtttgcgtcggcgagacgctcgagcagcgcgaatcg
ggcgcgaccgagcaggtcgtcggcgcgcagctcgatgccgtgctcgcggtgttgagcgcg
gacgaagcagcgcgcatcgtcgtcgcgtacgaaccggtgtgggcgatcggcaccggcaag
agcgcgacgtccgcgcaggcgcaggacgtgcacgcattcctgcgcgcgcggctcgcggcc
aagggtgcggccgacgtatcggtgctgtacggcggcagcgtgaagccggacaacgcggaa
gaactgttcgcacagccggacatcgacggcggcctgatcggcggcgcgtcgctgaaggcg
gaagattttctggcgatctgccgggccgcgcgttga

DBGET integrated database retrieval system