KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_1085Help
Entry
Bmul_1085         CDS       T00624                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00010  Glycolysis / Gluconeogenesis
bmu00620  Pyruvate metabolism
bmu00640  Propanoate metabolism
bmu00680  Methane metabolism
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01120  Microbial metabolism in diverse environments
bmu01130  Biosynthesis of antibiotics
bmu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmul_1085
   00620 Pyruvate metabolism
    Bmul_1085
   00640 Propanoate metabolism
    Bmul_1085
  Energy metabolism
   00680 Methane metabolism
    Bmul_1085
Enzymes [BR:bmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bmul_1085
Lipid biosynthesis proteins [BR:bmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bmul_1085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABX14776
UniProt: A0A0H3KPX6
Position
1:1183350..1185332
Genome map
AA seq 660 aa AA seqDB search
MSAIESVLHESRQFAPPAALEKAATISGMEAYRALAAEAERDYEGFWARLAREGLAWHKP
FTKVLDESDAPFYKWFDDGELNASYNCLDRHVEAGNGERVAVIFEADDGTVTRVTYADLL
ARVSRFANALKKRGIGKGDRVVIYMPMSIEGIVAMQACARIGATHSVVFGGFSAKSLNER
LVDVGAVALITADEQVRGGKTLPLKNIADEAIAMGGCDAVKSVIVYRRTGGKIDWHADRD
LWMHELADGESDTCAPEWVGAEHPLFILYTSGSTGKPKGVQHSTGGYLLWAAQTMKWTFD
WKPTDVFWCTADIGWVTGHTYITYGPLACGGTQVVFEGVPTYPDAGRFWKMIGDHKVSVF
YTAPTAIRSLIKAAEADEKVHPKSYDLSSLRIIGTVGEPINPEAWMWYHKHVGQERCPIV
DTWWQTETGGHMITPLPGATPTVPGSCTLPLPGIMAAVVDETGQDVPNGQGGILVVKRPW
PSMIRTIWGDPERFKKSYYPEELGGTLYLAGDGTVRDKDTGYFTIMGRIDDVLNVSGHRL
GTMEIESALVAHELVAEAAVVGRPDDTTGEAVVAFVVLKRARPEGEEAAALAKALRDWVG
KQIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEAITQDTSTLENPAILEQLTEAR
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgattgaatcggttcttcacgaaagccgccagtttgcgcctcccgcggcgctc
gagaaggcggcgaccatttccggcatggaggcctatcgcgcactggccgccgaggccgag
cgcgattacgaagggttctgggcgcgcctcgcgcgcgagggcctcgcgtggcacaagccg
tttacgaaggtgctcgacgagtccgatgcgccgttctacaagtggttcgacgacggcgaa
ctgaatgcgtcgtacaactgtctcgaccgccacgtcgaagccggcaacggcgagcgcgtc
gcggtgatcttcgaggccgacgacggcaccgtcacgcgcgtcacctatgccgacctgctc
gcgcgcgtctcgcgcttcgccaatgcgctgaagaaacgcggcatcggcaagggcgaccgc
gtcgtcatctacatgccgatgtcgatcgaaggcatcgtcgcgatgcaggcctgcgcgcgc
atcggcgcgacgcactcggtcgtgttcggcggcttctccgcgaaatcgctgaacgagcgg
ctcgtcgacgtcggtgcagtcgcgctgatcacggccgacgagcaggtgcgcggcggcaag
acgctgccgctgaagaacatcgccgacgaagcgatcgcgatgggcggctgcgacgcggtg
aagagcgtgatcgtctatcgccgcacgggcggcaagatcgactggcatgccgatcgcgac
ctgtggatgcacgaactggccgacggcgaatccgacacctgcgcgcccgaatgggtcggc
gccgagcatccgctgttcatcctctacacgtccggttcgaccggcaagccgaagggcgtg
cagcacagcacgggcggctacctgctgtgggccgcgcagacgatgaagtggaccttcgac
tggaagcccaccgacgtgttctggtgcacggcggacatcggctgggtcacgggccacacc
tacatcacctacggtccgctcgcatgcggcggcacgcaggtcgtgttcgaaggcgtgccg
acgtatcccgatgcgggccgcttctggaagatgatcggcgatcacaaggtcagcgtgttc
tatacggcgccgaccgcgatccgctcgctgatcaaggccgccgaagccgacgaaaaagtg
catccgaagagttacgacctgtcgagcctgcgcatcatcggcacggtcggcgagccgatc
aatccggaagcatggatgtggtaccacaagcacgtcggccaggagcgctgcccgatcgtc
gacacgtggtggcagacggaaaccggcggccacatgatcacgccgctgccgggcgcgacg
ccgacggtgcccggttcatgcacgctgccgctgccgggcatcatggccgcggtcgtcgac
gagacgggccaggacgtgccgaacggtcagggcggcattctggtcgtcaagcggccgtgg
ccgtcgatgatccgcacgatctggggcgacccggagcgcttcaagaagagctactacccc
gaggaactcggcggcacgctgtatctggccggcgacggcaccgtgcgcgacaaggacacc
ggctacttcacgatcatgggccgcatcgacgacgtgctgaacgtgtccggtcaccggctc
ggcacgatggagatcgagtcggcgctcgtcgcgcacgagctcgtggccgaagctgcggtg
gtcggccgccccgacgacacgacgggcgaagcggtggtcgcgttcgtcgtgctcaagcgc
gcgcggcccgaaggcgaagaagccgcggcgctcgcgaaggcgctgcgcgactgggtcggc
aagcagatcggcccgatcgcgaagccgaaggacatccgtttcggcgacaacctgccgaag
acgcgctcgggcaagatcatgcggcgcctgctgcgctcgctcgcgaagggcgaggcgatc
acgcaggacacgtccacgctcgagaatccggcgattctcgagcagctgaccgaagcgcgc
tga

DBGET integrated database retrieval system