KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_1134Help
Entry
Bmul_1134         CDS       T00624                                 

Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bmul_1134
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmul_1134
   00020 Citrate cycle (TCA cycle)
    Bmul_1134
   00620 Pyruvate metabolism
    Bmul_1134
Enzymes [BR:bmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bmul_1134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1250311..1251978
Genome map
AA seq 555 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEVLVKAGDTVEPEQSLVTLESDKATMDVPSPAAGTVKEV
KVKVGDAVSEGTLIILLEGGAAAQPNGAAAPAAAPAQASAPAPAAAAPAAAAPAAAPAAS
GGTLEVKVPDIGDYKDVPVIEIGVKVGDTVEKEQSLVTLESDKATMDVPSPAAGVVKDIK
VKVGDTVSEGTLIVLLEAAGAAPAAAAPQASAPAPAPAAAAPAAAPAPAPAKAAAPAAAS
AAAAPSGEHRASHASPSVRKFARELGVDVSRVQGSGPKGRITKEDVTAFVKGVMTGQQAA
PAAAAALAGGGELNLLPWPKVDFSKFGPFESKPLSRIKKISGANLHRNWVMIPHVTNNDE
ADITDLEALRVQLNKEHEKAGVKFTMLAFVIKAVVAALKKFPTFNASLDGDNLVFKQYYH
IGFAADTPNGLVVPVIRDADKKGLVEIAKEMAELSKAAREGKLKPDQMQGGCFSISSLGG
IGGTHFTPIINAPEVAILGLSRGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGAEAARFN
AYLGALLADFRRIIL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtgaaggtgccggatatcggcgattacaaggacgtgcccgtc
atcgaggtgctcgtgaaagcgggcgacacggtcgagcccgagcagtcgctcgtcacgctc
gagtccgacaaggcgacgatggacgtgccgagccccgccgcgggcacggtcaaggaagtg
aaggtcaaggtgggcgacgccgtgtcggaaggcacgctgatcatcctgctcgaaggcggc
gccgccgcgcagccgaacggcgccgctgcgccggcggcagcaccggcccaggcgtccgcg
ccggcaccggctgccgcggcccccgcggctgccgcaccggccgccgcgcccgccgcatcg
ggcggcacgctcgaagtgaaggtgcccgacatcggcgactacaaggacgtgccggtgatc
gagatcggcgtgaaggtcggcgacacggtcgagaaggagcagtcgctcgtcacgctcgaa
tcggacaaggcgacgatggacgtgccgagcccggccgccggcgtcgtgaaggacatcaag
gtgaaggtcggcgacaccgtgtcggaaggcacgctgatcgtgctgctcgaggccgccggc
gcagcgccggccgctgcggcgccgcaggcgagcgcaccggcgccggcaccggctgccgcc
gctccggctgccgcccccgcaccggcaccggcgaaggccgcggcaccggctgccgcatcg
gccgctgccgcgccgtcgggcgaacaccgtgcgagccacgcgtcgccgtcggtgcgcaag
ttcgcgcgcgaactgggcgttgacgtgtcgcgcgtgcagggcagcggtccgaagggccgc
atcacgaaggaagacgtcacggcgttcgtgaagggcgtcatgacgggccagcaggcggcg
ccggccgcagcggccgcgctggccggcggcggcgagctgaacctgctgccgtggccgaag
gtcgacttctcgaagttcggcccgttcgagtcgaagccgctgtcgcgcatcaagaagatc
tcgggcgcgaacctgcatcgcaactgggtgatgatcccgcacgtcacgaacaacgacgaa
gccgacatcaccgatctcgaagcgctgcgcgtgcagctgaacaaggagcacgagaaggcg
ggcgtgaagttcacgatgctcgcattcgtgatcaaggcggtcgtcgccgcgctgaagaag
ttcccgaccttcaacgcgagcctcgacggcgacaacctggtgttcaagcagtactaccac
atcggtttcgcggccgacacgccgaacggtctcgtcgtgccggtgatccgcgatgcggac
aagaagggcctcgtcgaaatcgcgaaggaaatggcggagctgtcgaaggccgcgcgcgaa
ggcaagctgaagccggaccagatgcagggcggctgcttctcgatctcgtcgctcggcggg
atcggcggcacgcatttcacgccgatcatcaacgcgccggaagtcgcgatcctcggcttg
tcgcgcggccagatgaagccggtgtgggacggcaagcagttcgtgccgcgtctgacgctg
ccgctgtcgctgtcgtatgaccatcgtgtgatcgatggcgcggaggctgcgcggttcaat
gcgtatctcggcgcgttgctcgcggatttccgtcgcatcattctttga

DBGET integrated database retrieval system