KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_1225Help
Entry
Bmul_1225         CDS       T00624                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00620  Pyruvate metabolism
bmu00630  Glyoxylate and dicarboxylate metabolism
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01120  Microbial metabolism in diverse environments
bmu01200  Carbon metabolism
Module
bmu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bmul_1225
   00630 Glyoxylate and dicarboxylate metabolism
    Bmul_1225
Enzymes [BR:bmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bmul_1225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABX14913
UniProt: A0A0H3KPM1
Position
1:complement(1346284..1347876)
Genome map
AA seq 530 aa AA seqDB search
MSTPITLPQGLAITGEIKPGYEAILTPDALELVAALHRAFEPRRQALLQARVERTKRLDA
GERPDFLPETKAIREGDWKVAPLPADLQCRRVEITGPVERKMIINALNSGADSYMTDFED
SNAPSWTNQIDGQINLKDAVRRTISLEQNGKSYKLNDKIATLIVRPRGWHLDEKHVTVDG
QRVSGGIFDFALFLFHNAKELIARGSGPYFYLPKMESHLEARLWNDIFVAAQEAIGIPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDRDFCLADRSKI
TMTVPFMRAYALLLLKTCHKRNAPAIGGMSALIPIKNDPEANEKAMAGVRSDKQRDATDG
YDGGWVAHPGLVPIAMEEFVKVLGDKPNQIGKQRDDVQVEGKNLLDFQPEAPITEAGLRN
NINVGIHYLGAWLDGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGVLEDGRKVTAELV
REFAKAELENVKRSVGGNTQPYERAAAIFEQMSTSEGFTEFLTLPLYEEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgatcacgctgccgcaaggcttggcgatcaccggcgagatcaagccgggt
tacgaagcgatcctgacgcccgacgcgctcgagctcgtcgctgcgctgcatcgcgcgttc
gaaccgcgccgccaggcgctgctgcaggcgcgcgtcgagcgcacgaagcgtctcgacgcc
ggcgagcgccccgattttctgcccgagacgaaggccatccgcgaaggcgactggaaggtc
gcaccgctgccggccgacctgcagtgccgccgcgtcgagatcaccggccccgtcgagcgc
aagatgatcatcaatgcgctgaactcgggcgccgattcgtacatgacggacttcgaggat
tcgaacgcgccgagctggacgaatcagatcgacggccagatcaacctgaaggacgcggtg
cgccgcacgatctcgctcgagcagaacggcaagtcgtacaagctgaacgacaagatcgcg
acgctaatcgtgcgtccgcgcggctggcacctcgacgagaagcacgtgacggtcgacggc
cagcgtgtgtccggcggcatcttcgatttcgcgctgttcctgttccataacgcgaaggag
ctgatcgcgcgcggttcgggcccgtacttctacctgccgaagatggaaagccacctcgag
gcgcgcctgtggaacgacatcttcgtcgccgcgcaggaagcgatcggcattccgcgcggc
acgatccgcgcgacggtgctgatcgagacgatcctcgccgcgttcgaaatggacgagatc
ctctacgagctgcgcgaacacagctcgggcctgaacgcgggccgctgggactacattttc
tcggcgatcaagaagttcaagaacgatcgcgacttctgcctcgccgatcgttcgaagatc
acgatgacggtgccgttcatgcgcgcctacgcgctgctgctgctgaagacctgccacaag
cgcaatgcgccggcgatcggcgggatgagcgcgctgattccgatcaagaacgatccggaa
gcgaacgagaaggcgatggccggcgtgcgttcggacaagcagcgcgatgcgacggacggc
tacgacggcggctgggtggcgcatccgggcctcgtgccgatcgcgatggaggaattcgtc
aaggtgctcggcgacaagccgaaccagatcggcaagcagcgcgacgacgtgcaggtcgag
ggcaagaacctgctcgacttccagcccgaggcgccgatcaccgaagcgggcctgcgcaac
aacatcaacgtcgggatccactatctcggcgcgtggctcgacggcaacggctgcgtgccg
attcacaacctgatggaagatgcggccaccgccgagatctcgcgctcgcaggtgtggcag
tggatccgctcgccgaagggcgtgctcgaggacggccgcaaggtcaccgcggaactcgtg
cgcgagttcgcgaaggccgagctcgagaacgtgaagcgctcggtcggcggcaacacgcag
ccttacgagcgtgcggcggcgatcttcgaacagatgtcgacgtcggaaggcttcaccgaa
ttcctgacgctgccgctgtacgaggaaatctga

DBGET integrated database retrieval system