KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_1229Help
Entry
Bmul_1229         CDS       T00624                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bmu01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bmu00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1350552..1351859)
Genome map
AA seq 435 aa AA seqDB search
MSRQQQAQELQKQWETDPRWKGIKRSYTAEDVVRLRGSIQVEHTLAKRGAEKLWELINNE
PFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVKR
INNTLTRADQIQWSEGKNPGDEGYVDFFAPIVADAEAGFGGVLNAFELMKAMIEAGASGV
HFEDQLASVKKCGHMGGKVLVPTREAVAKLSAARLAADVMGTPTVLVARTDAEAADLITS
DIDDNDKPFLTGERTVEGFFRTKPGLEQAVSRGLAYAPYADLIWCETGKPDLEYAKKFAE
AIHKQFPGKLLSYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSMF
NLAHGYARTQMSAFVELQQAEFAAADKGFTAVKHQREVGTGYFDAVTQTVEREASTTALH
GSTEDEQFFDGKKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtcagcaacaggcacaggaactgcaaaagcaatgggaaaccgatccgcgctgg
aagggcatcaagcgcagctacacggctgaagacgtggtgcgcctgcgcggctcgatccag
gtcgaacacacgctcgcgaagcgcggcgccgaaaagctgtgggagctgatcaacaacgag
ccgttcgtcaacgcgctcggcgcgctgaccggcaaccaggcgatgcagcaggtcaaggcc
ggcctgaaggcgatctacctgtccggctggcaggtcgcgggcgacgcgaacgtcgccggc
gagatgtatccggaccagtcgctgtatccggcgaactcggtgccgctcgtcgtgaagcgc
atcaacaacacgctgacgcgcgcagaccagatccagtggtccgaaggcaagaacccgggc
gacgaaggctatgtcgacttcttcgcgccgatcgtcgccgacgcggaagccggtttcggc
ggcgtgctgaacgcattcgagctgatgaaggcgatgatcgaggcaggcgcatcgggcgtg
cacttcgaagaccagctcgcatcggtcaagaagtgcggccacatgggcggcaaggtgctc
gtgccgacgcgcgaagcggtcgcgaagctctcggccgcgcgtctcgccgccgacgtgatg
ggcacgccgaccgtgctcgtcgcacgtaccgacgcggaagccgcagacctgatcacgtcc
gacatcgacgacaacgacaagccgttcctgaccggcgagcgcacggtcgaaggcttcttc
cgcaccaagccgggcctcgagcaggccgtgtcgcgcggcctcgcgtatgcgccgtacgcc
gatctgatctggtgcgaaaccggcaagccggatctcgaatacgcgaagaagttcgcggaa
gcgatccacaagcagttcccgggcaagctgctgtcgtacaactgctcgccgtcgttcaac
tggaagaagaacctcgacgacgcgacgatcgcgaagttccagaaggagctcggcgcgatg
ggctataagttccagttcatcacgctcgccggcttccacgcgctgaactactcgatgttc
aacctcgcgcacggctatgcacgcacgcagatgagcgcgttcgtcgagctgcagcaggcc
gagttcgcggcagccgacaagggcttcacggcggtcaagcaccagcgcgaagtcggtacc
ggctacttcgacgcggtcacgcagacggtcgagcgcgaagcgtcgacgactgccctgcac
ggctcgaccgaagacgagcagttcttcgacggcaagaaggtcgcgtaa

DBGET integrated database retrieval system