KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_1242Help
Entry
Bmul_1242         CDS       T00624                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Bmul_1242
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bmul_1242
Enzymes [BR:bmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Bmul_1242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1365272..1365751
Genome map
AA seq 159 aa AA seqDB search
MSSLYTFSADTLAGVPSTLDVYRGKVLLIVNTASECGFTPQYAGLQKLYERYAARGFFVL
GFPCNQFGKQEPGDAEQIGAFCERNYGVTFPIFAKIDVKGPNAHPLYRYLTDESPGIFGL
KAIKWNFTKFLIDRDGRIVKRYAPSTKPEDIAADIEKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccctgtatacattcagcgccgacacgctggccggtgtgccgagcacgctcgat
gtctatcgcggcaaggtgctcctgatcgtcaataccgcgagcgagtgcggtttcacgccg
cagtacgcggggctgcagaagctgtacgaacgctacgcggcgcgcggctttttcgtgctc
ggctttccatgcaaccagttcggcaagcaggagccgggcgacgccgagcagatcggcgcc
ttctgcgagcgcaattacggcgtcacgtttccgatattcgcgaagatcgacgtgaagggt
ccgaacgcgcatccgctgtatcgctacctgaccgacgagtcgcccggcatcttcggcctg
aaggcgatcaagtggaacttcacgaaattcctgatcgaccgcgacgggcgcatcgtgaag
cgctacgcgccgtcgacaaagcccgaggacatcgccgcggatatcgaaaagctgctttga

DBGET integrated database retrieval system