KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_1355Help
Entry
Bmul_1355         CDS       T00624                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Bmul_1355
Enzymes [BR:bmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bmul_1355
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Bmul_1355
Lipid biosynthesis proteins [BR:bmu01004]
 Fatty acid synthase
  Component type
   Bmul_1355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1492786..1493340)
Genome map
AA seq 184 aa AA seqDB search
MIAVLGDSLSAEYGLPRDTGWVALLRQRLATERIDYSVANASVSGDTTSGGRARLPAVLQ
RLKPSIVVVELGANDALRGVPLATTEQNLRDIVADARRAHAKVVLVGMYVPSNYGPDYTQ
KFHAVYTRLAKELDVPLVPFLLAGIENKPDMFQSDQIHPTQQAQRVLLDNVWPTLKPLLG
KPRG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgccgtactcggcgacagcctctcggccgaatacgggctgccgcgcgacaccggc
tgggtcgcgctgctgcggcaacggctcgcgacggagcgaatcgattatagcgtcgcgaat
gcgagcgtcagcggcgacaccacgagcggcggccgcgcacggctgccggccgtgctgcag
cggctcaagccgtcgatcgtcgtcgtcgagctcggcgcgaacgacgcactgcgcggcgtg
ccgctcgcgacgaccgagcagaatctgcgcgacatcgtcgccgatgcgcggcgcgcgcac
gccaaagtcgtgctggtcggcatgtacgtgccgtcgaattacggccccgactacacgcag
aagttccatgcggtctatacgcgactggcgaaggaactcgacgtgccgctcgtgccgttc
ctgctcgccggcatcgagaacaagcccgacatgttccagtccgaccagatccatccgacg
cagcaggcgcagcgcgtgctgctcgacaacgtgtggccgacgctgaagccgctgctcggc
aagccgcgcggctga

DBGET integrated database retrieval system