KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_1369Help
Entry
Bmul_1369         CDS       T00624                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bmu00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1511843..1512475
Genome map
AA seq 210 aa AA seqDB search
MKRTDDVLLVIDVQYDFMPGGALAVADGDAVVPVINALAQRFERVVITQDWHPREHVSFA
ANHPDGEPFSTIALPYGEQVLWPVHCVQDTEGAALHRDLDLPHAQLVIRKGCDARVDSYS
AFVEADRTTRTGLAGYLREIGAKRVWCCGLATDYCVAWSALDARAAGFDAAVIDDACRAI
DLNGSLAQAWQQMQAAGVARVTSDGVRASA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaccgacgacgtcctgctcgtgatcgacgtgcagtacgacttcatgccgggc
ggcgcgctggccgtcgccgacggcgacgcggtcgtgcccgtgatcaacgcgctcgcgcag
cggttcgagcgcgtcgtgatcacgcaggactggcatccgcgcgagcacgtgtcgttcgcg
gcgaatcatccggacggcgaaccgttctcgacgatcgcgctgccgtacggcgagcaggtg
ctgtggcccgtgcactgcgtgcaggacaccgaaggcgcggcgctgcatcgcgacctcgac
ctgccgcacgcgcagctcgtgattcgcaagggctgcgatgcgcgcgtcgacagctattcc
gcattcgtcgaagccgatcgcacgacgcgcacggggctcgccggctatctgcgcgagatc
ggcgcgaaacgcgtctggtgctgcgggctcgcgaccgactattgcgtcgcgtggtcggcg
ctcgacgcgcgcgcggcgggcttcgacgccgcggtgatcgacgatgcgtgccgcgcgatc
gacctgaacggctcgctcgcgcaggcatggcagcagatgcaggcggcgggcgtcgcacgc
gtgacgtccgatggcgtgcgcgccagcgcatag

DBGET integrated database retrieval system