KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_1451Help
Entry
Bmul_1451         CDS       T00624                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
Enzymes [BR:bmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Bmul_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1597277..1598206
Genome map
AA seq 309 aa AA seqDB search
MSGERAKRFPLALEDLKRAPRKSDGRPGERHALAASKSADGPVAVPKPGAARGVPAGLAA
AKPATAPKATAPKPTLPKPAAPRPIAPSAAPAGAFALTSERVRERMVERLRANGVADARV
LAAMAAVPRHLFVDPGLATQAYEDSALPIGHQQTISKPSVVARMIELAMAGRSLERVLEI
GTGCGYQAAVLSHVARDVYSIERIKPLYERAKLNLRPLRVPNIRLHYGDGRVGLPSAAPF
DAIVIAAAGLDVPQALLEQLAIGGRLIAPVGAQSGQPQVLTLVERVAHAQWRESRLDRVF
FVPLKSGVI
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgagcgcgcgaagcggttcccgctcgcgctcgaagatctcaagcgagcgcca
cgcaaatccgacgggcggcccggcgaacgccatgcgctcgccgcatcgaagtccgccgac
ggtccggtcgccgtgccgaagcccggcgcggcgcgcggcgtgccggccggcctcgctgcc
gcgaagcccgcgacggcgccgaaggccaccgcaccgaagccgacgctgccgaagcctgcc
gcaccgcggccgatcgcaccgagcgcggcgccggccggcgcgttcgcgctcacctcggaa
cgcgtgcgcgagcgcatggtcgaacggttgcgtgcgaacggcgtcgccgacgcgcgcgtg
ctggcggcgatggcggcggtgccgcgccacctgttcgtggatcccggcctcgcgacgcag
gcctacgaggattccgcactgccgatcggccaccagcagaccatttcgaagccgtcggtc
gtcgcgcgcatgatcgagctcgcgatggccggccgctccctcgagcgcgtcctcgaaatc
ggcaccggctgcggctatcaggccgcggtgctgagccacgtggcgcgcgacgtgtattcg
attgaacgcatcaagccgctgtacgagcgcgcgaagctgaacctgaggccgctgcgcgtg
ccgaacatccgtctgcactacggcgacgggcgtgtcggcctgccgtccgccgccccgttc
gatgcgatcgtgatcgcagccgcggggctcgacgtgccgcaggcgctgctcgagcagctc
gcgatcggcgggcgcctcatcgcgccggtcggtgcgcagagcgggcagccgcaggtcctc
acgctcgtcgagcgcgtcgcgcacgcgcagtggcgggagtctcggcttgatcgcgttttc
tttgtccctttaaaatccggagtgatttga

DBGET integrated database retrieval system