KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_1746Help
Entry
Bmul_1746         CDS       T00624                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bmul_1746
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bmul_1746
  Amino acid metabolism
   00310 Lysine degradation
    Bmul_1746
Enzymes [BR:bmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bmul_1746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1928372..1929664)
Genome map
AA seq 430 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQVIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAPAAQPAAATAAASTAT
ASSGTASPAAAKLLAEKGLSAGDVAGSGRDGRVTKGDALAAGSAPKAAAPAAAPAKAAAK
PALPEVKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMD
LRAKYKDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGS
PRGLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLST
PIINPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDAL
EDPARLLLDL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtgtcggaagccaccatg
ctgcagtggaagaagaagccgggcgaagcagtcgcgcaggacgaaatcctgatcgaactc
gagaccgacaaggtcgtgctcgaagtgccggcgccggccgcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacacggtggtcgccgatcaggtgatcgcgacgatcgacaccgaa
gcgaaggcgggcgccgccgaagccgcggcaggcgcagccgaagtcaagccggccgccgca
cccgcagcggcaccggccgctcagccggccgccgcgacggctgccgcgtcgacggccacc
gcttcgtcgggcacggcctcgccggccgcagcgaagctgctggccgagaagggcctgtcg
gcaggcgacgtcgccggctcgggccgcgacggccgcgtcacgaagggcgacgcgctcgcc
gccggcagcgcgccgaaggcggctgctccggccgccgcaccggcaaaggccgcggccaag
ccggcgctgccggaagtgaaggtgccggcgtcggcaacgacctggctgaacgaccgtccg
gaacaacgcgtgccgatgtcgcgcctgcgtgcgcgtatcgccgagcgtctgctcgagtcg
cagcagaccaacgcgatcctgacgacgttcaacgaagtcaacatgcagccggtcatggac
ctgcgcgcgaagtacaaggacaagttcgagaaggaacacggcgtgaagctcggcttcatg
tcgttcttcgtgaaggcggccgtgcatgcgctgaagaagttcccgctcgtgaacgcgtcg
atcgacggcaacgacatcgtctaccacggctacttcgacatcggtatcgcggtcggttcg
ccgcgcggcctcgtcgtgccgatcctgcgcaacgccgatcagctgagcctcgccgagatc
gagaagaagatcgccgaattcggccagaaggcgaaggacggcaagctgtcgatcgaggaa
atgacgggcggtacgttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgacc
ccgatcatcaacccgccgcagtcggcaatcctcggcgtgcacgcgacgaaggagcgtccg
gtcgtcgaaaacggccagatcgtgatccgtccgatcaactacctcgcgctgtcgtacgac
caccgcatcatcgacggccgcgaagccgtgctgtcgctcgtcgcgatgaaggatgcgctg
gaagatccggcacgtctgctgctcgacctgtaa

DBGET integrated database retrieval system