KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_1875Help
Entry
Bmul_1875         CDS       T00624                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bmul_1875
   00052 Galactose metabolism
    Bmul_1875
   00500 Starch and sucrose metabolism
    Bmul_1875
   00520 Amino sugar and nucleotide sugar metabolism
    Bmul_1875
Enzymes [BR:bmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bmul_1875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2049759..2050643
Genome map
AA seq 294 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEVEAELEARGKEKLLELVRSIKPSHVDCFYVRQPEALGLGHAVLCAEK
LVADNPFAVILADDLLDGNPPVMKQMVDVFDHYHSSVIGVEEIPPSETKSYGIVDGKEWE
DSIIKMSAIVEKPAPDVAPSNLGVVGRYVLKPRIFDHLRALKPGAGGELQLTDAIEALLA
DEQVLAYKYQGTRYDCGSKLGYLKATVEFALRHPEVGADFETYLRTRDGAQPAA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaggcggtattccctgttgccggcctcggcacgcggttcctcccg
gcaacaaaggcgagcccgaaggagatgctgccggtcgtggacaagccgctgatccagtac
gcggtcgaagaagcgatcgcggccggcatcaccgaaatgatcttcgtgacggggcgcagc
aagcgcgcgatcgaggaccatttcgacaagtcctacgaggtcgaagccgaactcgaggcc
cgcggcaaggaaaaactgctcgagctcgtgcgcagcatcaagccgagccacgtcgactgc
ttctacgtgcgccagccggaagcgctcggcctcggccacgccgtgctgtgcgccgaaaag
ctggtcgcggacaacccattcgcggtgatcctcgcggacgacctgctcgacggcaatccg
cccgtgatgaagcagatggtcgacgtgttcgatcactatcacagctcggtgatcggcgtc
gaagagatcccgccgtcggagacgaagtcgtacgggatcgtcgacggcaaggaatgggaa
gactcgatcatcaagatgtcggcgatcgtcgagaagccggcgccggacgtcgcgccgtcg
aacctcggcgtggtcggccgctacgtgctgaagccgcggatcttcgatcatctgcgcgcg
ctgaagccgggcgcgggcggcgagctgcagctcaccgacgcgatcgaggcgctgctcgcc
gacgagcaggtgctcgcgtacaaatatcagggcacgcgctacgactgcggcagcaagctc
ggctatctgaaggcgacggtcgaattcgcgctgcgccatccggaagtcggcgccgacttc
gaaacctatctgcgcacgcgcgacggcgcgcagccggccgcctga

DBGET integrated database retrieval system