KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_1913Help
Entry
Bmul_1913         CDS       T00624                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
Enzymes [BR:bmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Bmul_1913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2091726..2093111)
Genome map
AA seq 461 aa AA seqDB search
MKLRLPRIGALVRPWRRAGRALALAAALAAVAGCDAQPGAGAALAQPAAASGAAQRAAAP
ASAAAGDGAPIVATNRPQTRAQVYEGVRRMTALGKQLFFDPTLSGSGKLACASCHSPEHA
FGPPNALSVQLGGDDMRRAGFRAVPSLKYLQGVPPFAEHFHDSDDEGDESVDAGPTGGLT
WDGRVDTGAAQARIPLTSPFEMNSSPAKVARAVRAAPYADAFRAVFGANVLDDDRATFDA
VLRALGTFEQTPSLFAPYTSKYDAYLAGRAQLTPAELHGLQLFNDEKKGNCASCHVSQRA
LDGTPPQFSDFGLIAIAVPRNRALPVNRDPRFYDLGACGPERTDLKGRDEFCGLFRTPSL
RNVALRKTFFHNGVYHSLEDVMHFYAERDIHPEKFYPVVYGRVQRYDDLPKRYWTNINRE
PPFDRKPGDRPALDEAEIKDVIAFLNTLTDGYQPTATQARR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcgcctaccgagaatcggcgcgctcgtgcgcccgtggcggcgcgcgggccgc
gcgcttgcgctggccgccgcgctcgccgccgttgcgggctgcgacgcgcagcccggcgcg
ggtgccgcgctcgcccagcccgccgccgcatcgggcgccgcgcagcgtgcggccgcaccg
gcgtcggccgctgccggcgacggcgcgccgatcgtcgcgacgaaccgtccgcagacgcgc
gcgcaagtttacgaaggcgtgcgccggatgaccgcgctcggcaagcaacttttcttcgac
cctacgctgtcaggttccggcaagctcgcgtgcgcgtcgtgccacagccccgagcatgcg
ttcgggccgccgaacgcgctgtcggtgcagctcggcggcgacgacatgcggcgtgccggg
tttcgcgcggtgccgtcgctgaagtatctgcagggcgtgccgccgttcgccgagcacttc
cacgattcggacgacgaaggtgacgagagcgtcgatgccggcccgaccggcggcctcacg
tgggacggccgcgtcgacacgggcgccgcgcaggcgcgcattccgctcacgtcgccgttc
gagatgaacagttcgcccgcaaaggtcgcgcgcgcggtgcgcgcggcaccatacgcggac
gcgtttcgcgccgtgttcggcgcgaacgtgctcgacgacgatcgcgcgacgttcgacgcc
gtgctgcgcgcactcggcacgttcgagcagacgccgtcgctgttcgcgccgtacacgagc
aagtacgacgcgtacctcgcgggccgtgcgcagctcacgcctgccgagctgcacggactg
cagctcttcaacgacgagaagaagggcaactgcgcgagctgccacgtgagtcagcgcgcg
ctggacggcacgccgccgcagttcagcgatttcgggctgatcgcgatcgcggtgccgcgc
aaccgcgcgctgccggtcaatcgcgatccgcgcttctacgatctcggcgcatgcgggccc
gagcggaccgacctgaagggccgcgacgaattctgcgggctgttccgcacgccgtcgctg
cgcaacgtcgcgctgcgcaagacgttcttccacaacggcgtgtatcactcgctcgaggac
gtgatgcatttctacgcggagcgcgacatccatccggagaagttctatccggtcgtgtac
ggccgcgtgcagcgctacgacgatctgccgaagcgctactggacgaacatcaaccgcgag
ccgccgttcgaccgcaagccgggcgatcggcccgcgctcgacgaggccgagatcaaggac
gtgatcgcgtttctgaacacgctgaccgacggatatcaacctacggcgactcaggcccgc
cgctag

DBGET integrated database retrieval system